BLASTX nr result
ID: Panax24_contig00036626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00036626 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM95400.1 hypothetical protein DCAR_018642 [Daucus carota subsp... 53 3e-09 >KZM95400.1 hypothetical protein DCAR_018642 [Daucus carota subsp. sativus] Length = 686 Score = 52.8 bits (125), Expect(2) = 3e-09 Identities = 32/90 (35%), Positives = 44/90 (48%) Frame = +2 Query: 137 WDEAIEDPPSNSVGKKMKTYGSDCRSPTSKGGVKNIYTQETHCTKQDNLQLRENVYGSGK 316 W ++ P + +GKK + +GS+ RSP + N Y E C KQ++ EN Sbjct: 275 WYKSSGIPQFDLLGKKTRAHGSEYRSPVRR----NRYCHELDCKKQES----ENC----- 321 Query: 317 CARMSSPTPKTKFQKIIGPDKSWLFEDEDI 406 P P FQK GP + WLFEDED+ Sbjct: 322 ------PIPTANFQKRKGPHEKWLFEDEDV 345 Score = 35.8 bits (81), Expect(2) = 3e-09 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +1 Query: 1 FTTPDGTCVRYPMFARTSGVKPVISQPAWSCF 96 FT P GT +P RT+ V+ VI+QPAWS F Sbjct: 243 FTNPKGTW--FPNLQRTTSVRSVINQPAWSSF 272