BLASTX nr result
ID: Panax24_contig00036565
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00036565 (654 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM88922.1 hypothetical protein DCAR_025997 [Daucus carota subsp... 67 2e-09 XP_017217620.1 PREDICTED: transformation/transcription domain-as... 67 2e-09 >KZM88922.1 hypothetical protein DCAR_025997 [Daucus carota subsp. sativus] Length = 3706 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/51 (62%), Positives = 34/51 (66%) Frame = +2 Query: 500 KVYQNFRLTVTHFLESGVVPPPAPXXXXXXXXXXXXXXIEDVKPLTMDMSD 652 K+YQNFRLTVTHF ESG VPPPAP IEDVKPL MD+SD Sbjct: 145 KIYQNFRLTVTHFFESGAVPPPAPAISGSNSTTSALSTIEDVKPLAMDISD 195 >XP_017217620.1 PREDICTED: transformation/transcription domain-associated protein [Daucus carota subsp. sativus] Length = 3895 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/51 (62%), Positives = 34/51 (66%) Frame = +2 Query: 500 KVYQNFRLTVTHFLESGVVPPPAPXXXXXXXXXXXXXXIEDVKPLTMDMSD 652 K+YQNFRLTVTHF ESG VPPPAP IEDVKPL MD+SD Sbjct: 145 KIYQNFRLTVTHFFESGAVPPPAPAISGSNSTTSALSTIEDVKPLAMDISD 195