BLASTX nr result
ID: Panax24_contig00036538
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00036538 (567 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010099201.1 hypothetical protein L484_002032 [Morus notabilis... 74 1e-13 >XP_010099201.1 hypothetical protein L484_002032 [Morus notabilis] EXB77144.1 hypothetical protein L484_002032 [Morus notabilis] Length = 134 Score = 73.9 bits (180), Expect = 1e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 256 MLWVGNLCSSLLHFRCLRSSSCPSVLQSWSTPAV 357 MLWVGNLCSSLLHFRCLRSSSCPSV QSWSTPAV Sbjct: 1 MLWVGNLCSSLLHFRCLRSSSCPSVSQSWSTPAV 34