BLASTX nr result
ID: Panax24_contig00036444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00036444 (538 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010087235.1 hypothetical protein L484_009744 [Morus notabilis... 43 3e-06 >XP_010087235.1 hypothetical protein L484_009744 [Morus notabilis] EXB28585.1 hypothetical protein L484_009744 [Morus notabilis] Length = 529 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 26/79 (32%), Positives = 40/79 (50%) Frame = -3 Query: 323 TFAGFSADSLVNHLINSVLIATHHKRPENTTGLGKGLVYEEKGIESEVSGNEIYIDEAIN 144 T GFS +S VN + S+LI TH ++PEN +G+ G + + +++ DE Sbjct: 67 TTTGFSLNSSVNEVKGSILINTHFRKPENASGIS-----VISGRKRKSGKSQVLKDEENE 121 Query: 143 GNSFITQEHISDSSPGKVE 87 G+ F E SS K+E Sbjct: 122 GDDFTDNEKNGVSSSEKIE 140 Score = 35.0 bits (79), Expect(2) = 3e-06 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = -2 Query: 60 KSKSLCDVTKGKWVFDENYP 1 K ++ CDVT+G+WV++E+YP Sbjct: 177 KRRAKCDVTRGRWVYEESYP 196