BLASTX nr result
ID: Panax24_contig00036415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00036415 (523 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017248477.1 PREDICTED: F-box/LRR-repeat protein 3-like [Daucu... 62 6e-08 >XP_017248477.1 PREDICTED: F-box/LRR-repeat protein 3-like [Daucus carota subsp. sativus] KZM97283.1 hypothetical protein DCAR_015355 [Daucus carota subsp. sativus] Length = 667 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 406 AMKRQKSAPETNINLFDHLSEEIIFTILDSLTDNPFDTK 522 AMK+QK+ P +N NLFDHLSEE+IF ILD L D+PFD+K Sbjct: 2 AMKKQKTTPSSNFNLFDHLSEELIFLILDHLKDSPFDSK 40