BLASTX nr result
ID: Panax24_contig00036351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00036351 (474 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011076453.1 PREDICTED: uncharacterized protein LOC105160671 [... 58 7e-07 XP_002318431.2 hypothetical protein POPTR_0012s02340g [Populus t... 53 2e-06 XP_012858555.1 PREDICTED: uncharacterized protein LOC105977740 [... 57 2e-06 OAY30565.1 hypothetical protein MANES_14G041100 [Manihot esculenta] 55 4e-06 OAY30566.1 hypothetical protein MANES_14G041100 [Manihot esculenta] 55 5e-06 XP_010274495.1 PREDICTED: uncharacterized protein LOC104609811 [... 55 5e-06 XP_016515914.1 PREDICTED: transmembrane protein 135-like [Nicoti... 54 6e-06 >XP_011076453.1 PREDICTED: uncharacterized protein LOC105160671 [Sesamum indicum] Length = 521 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 428 YLKTLDAMKKPKLQDSRETETSVSETYKLESIPGL 324 YL+TLDAMKKP++QD+RE ETS SE Y LESIPGL Sbjct: 487 YLQTLDAMKKPQVQDNRENETSSSEKYNLESIPGL 521 >XP_002318431.2 hypothetical protein POPTR_0012s02340g [Populus trichocarpa] EEE96651.2 hypothetical protein POPTR_0012s02340g [Populus trichocarpa] Length = 66 Score = 52.8 bits (125), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 428 YLKTLDAMKKPKLQDSRETETSVSETYKLESIPGL 324 YL+TLDA+KKPK Q+SRE E S S+ Y LESIPGL Sbjct: 32 YLQTLDAIKKPKSQESREDEASPSQKYNLESIPGL 66 >XP_012858555.1 PREDICTED: uncharacterized protein LOC105977740 [Erythranthe guttata] EYU20159.1 hypothetical protein MIMGU_mgv1a004489mg [Erythranthe guttata] Length = 525 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 428 YLKTLDAMKKPKLQDSRETETSVSETYKLESIPGL 324 YL+TLDAMKKP +QD+RE ETS SE Y LESIPGL Sbjct: 491 YLQTLDAMKKPDVQDNRENETSNSEKYNLESIPGL 525 >OAY30565.1 hypothetical protein MANES_14G041100 [Manihot esculenta] Length = 367 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 428 YLKTLDAMKKPKLQDSRETETSVSETYKLESIPGL 324 YL+TLDAMK+PKLQ+SRE E S S+ Y LESIPGL Sbjct: 333 YLQTLDAMKQPKLQESREAEASSSQKYNLESIPGL 367 >OAY30566.1 hypothetical protein MANES_14G041100 [Manihot esculenta] Length = 524 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -2 Query: 428 YLKTLDAMKKPKLQDSRETETSVSETYKLESIPGL 324 YL+TLDAMK+PKLQ+SRE E S S+ Y LESIPGL Sbjct: 490 YLQTLDAMKQPKLQESREAEASSSQKYNLESIPGL 524 >XP_010274495.1 PREDICTED: uncharacterized protein LOC104609811 [Nelumbo nucifera] Length = 529 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 428 YLKTLDAMKKPKLQDSRETETSVSETYKLESIPGL 324 YL+T D +KKPKLQ+SR TETS SE Y LESIPGL Sbjct: 495 YLQTFDVIKKPKLQESRGTETSASEKYNLESIPGL 529 >XP_016515914.1 PREDICTED: transmembrane protein 135-like [Nicotiana tabacum] Length = 191 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 428 YLKTLDAMKKPKLQDSRETETSVSETYKLESIPGL 324 YL TLDAMK+PK+ D+RETET +E Y LESIPGL Sbjct: 157 YLHTLDAMKEPKVPDNRETETLTAEKYNLESIPGL 191