BLASTX nr result
ID: Panax24_contig00035999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00035999 (452 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016562731.1 PREDICTED: regulator of telomere elongation helic... 58 7e-07 XP_016562730.1 PREDICTED: regulator of telomere elongation helic... 58 7e-07 XP_016562728.1 PREDICTED: regulator of telomere elongation helic... 58 7e-07 XP_018633409.1 PREDICTED: regulator of telomere elongation helic... 55 4e-06 XP_016472028.1 PREDICTED: regulator of telomere elongation helic... 55 4e-06 XP_009626149.1 PREDICTED: regulator of telomere elongation helic... 55 4e-06 XP_016472027.1 PREDICTED: regulator of telomere elongation helic... 55 4e-06 XP_009626148.1 PREDICTED: regulator of telomere elongation helic... 55 4e-06 XP_016472026.1 PREDICTED: regulator of telomere elongation helic... 55 4e-06 XP_009774071.1 PREDICTED: regulator of telomere elongation helic... 55 6e-06 XP_009774070.1 PREDICTED: regulator of telomere elongation helic... 55 6e-06 XP_009774068.1 PREDICTED: regulator of telomere elongation helic... 55 6e-06 XP_009774067.1 PREDICTED: regulator of telomere elongation helic... 55 6e-06 >XP_016562731.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X3 [Capsicum annuum] Length = 869 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DRLPLL RFKDYVPAKY SLY+QYLK T EV G Sbjct: 836 DRLPLLHRFKDYVPAKYHSLYDQYLKRTHEVAG 868 >XP_016562730.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X2 [Capsicum annuum] Length = 1032 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DRLPLL RFKDYVPAKY SLY+QYLK T EV G Sbjct: 999 DRLPLLHRFKDYVPAKYHSLYDQYLKRTHEVAG 1031 >XP_016562728.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X1 [Capsicum annuum] Length = 1040 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DRLPLL RFKDYVPAKY SLY+QYLK T EV G Sbjct: 1007 DRLPLLHRFKDYVPAKYHSLYDQYLKRTHEVAG 1039 >XP_018633409.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X3 [Nicotiana tomentosiformis] Length = 843 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 810 DRIPLLHRFKDYVPAKYHSLYDQYLKRNLEVAG 842 >XP_016472028.1 PREDICTED: regulator of telomere elongation helicase 1-like isoform X3 [Nicotiana tabacum] Length = 1027 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 994 DRIPLLHRFKDYVPAKYHSLYDQYLKRNLEVAG 1026 >XP_009626149.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X2 [Nicotiana tomentosiformis] Length = 1027 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 994 DRIPLLHRFKDYVPAKYHSLYDQYLKRNLEVAG 1026 >XP_016472027.1 PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Nicotiana tabacum] Length = 1041 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 1008 DRIPLLHRFKDYVPAKYHSLYDQYLKRNLEVAG 1040 >XP_009626148.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X1 [Nicotiana tomentosiformis] Length = 1041 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 1008 DRIPLLHRFKDYVPAKYHSLYDQYLKRNLEVAG 1040 >XP_016472026.1 PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Nicotiana tabacum] Length = 1042 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 1009 DRIPLLHRFKDYVPAKYHSLYDQYLKRNLEVAG 1041 >XP_009774071.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X4 [Nicotiana sylvestris] XP_016453745.1 PREDICTED: regulator of telomere elongation helicase 1-like isoform X3 [Nicotiana tabacum] Length = 843 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 810 DRIPLLHRFKDYVPAKYHSLYDQYLKRNHEVAG 842 >XP_009774070.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X3 [Nicotiana sylvestris] XP_016453744.1 PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Nicotiana tabacum] Length = 1027 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 994 DRIPLLHRFKDYVPAKYHSLYDQYLKRNHEVAG 1026 >XP_009774068.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X2 [Nicotiana sylvestris] Length = 1033 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 1000 DRIPLLHRFKDYVPAKYHSLYDQYLKRNHEVAG 1032 >XP_009774067.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X1 [Nicotiana sylvestris] XP_016453743.1 PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Nicotiana tabacum] Length = 1041 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 452 DRLPLLQRFKDYVPAKYQSLYEQYLK*TFEVEG 354 DR+PLL RFKDYVPAKY SLY+QYLK EV G Sbjct: 1008 DRIPLLHRFKDYVPAKYHSLYDQYLKRNHEVAG 1040