BLASTX nr result
ID: Panax24_contig00035450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00035450 (522 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI17294.3 unnamed protein product, partial [Vitis vinifera] 84 1e-15 XP_010650335.1 PREDICTED: kinesin-like protein KIN-12B [Vitis vi... 84 1e-15 KZM86984.1 hypothetical protein DCAR_024118 [Daucus carota subsp... 82 5e-15 XP_008337488.1 PREDICTED: kinesin-like protein KIN12B [Malus dom... 82 7e-15 XP_009373611.1 PREDICTED: kinesin-like protein KIN-12B [Pyrus x ... 82 7e-15 XP_009371095.1 PREDICTED: kinesin-like protein KIN-12B [Pyrus x ... 82 7e-15 EOY05083.1 Phragmoplast-associated kinesin-related protein, puta... 78 1e-13 XP_017975859.1 PREDICTED: kinesin-like protein KIN12B [Theobroma... 78 1e-13 EOY05081.1 Phragmoplast-associated kinesin-related protein, puta... 78 1e-13 XP_009378163.1 PREDICTED: kinesin-like protein KIN-12B [Pyrus x ... 78 1e-13 XP_010093879.1 Kinesin-like protein KIF15 [Morus notabilis] EXB5... 77 2e-13 OMO75912.1 hypothetical protein CCACVL1_15994 [Corchorus capsula... 77 4e-13 XP_011462843.1 PREDICTED: kinesin-like protein KIN12B [Fragaria ... 77 4e-13 XP_007225458.1 hypothetical protein PRUPE_ppa000288mg [Prunus pe... 77 4e-13 XP_018828254.1 PREDICTED: kinesin-like protein KIN-12B isoform X... 77 4e-13 XP_018828253.1 PREDICTED: kinesin-like protein KIN-12B isoform X... 77 4e-13 XP_011011106.1 PREDICTED: kinesin-like protein KIN12B isoform X2... 76 5e-13 XP_011011105.1 PREDICTED: kinesin-like protein KIN12B isoform X1... 76 5e-13 XP_002303008.1 PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED protein 1... 76 5e-13 XP_008222786.1 PREDICTED: kinesin-like protein KIN12B [Prunus mume] 76 5e-13 >CBI17294.3 unnamed protein product, partial [Vitis vinifera] Length = 1251 Score = 84.0 bits (206), Expect = 1e-15 Identities = 38/51 (74%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 +MAKYDA E T DQ+WR+EFEPFYNG D E +KL EPSSWFSGYDRCNI Sbjct: 1201 EMAKYDAGESHTACDQQWREEFEPFYNGEDSELSKLAEPSSWFSGYDRCNI 1251 >XP_010650335.1 PREDICTED: kinesin-like protein KIN-12B [Vitis vinifera] Length = 1376 Score = 84.0 bits (206), Expect = 1e-15 Identities = 38/51 (74%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 +MAKYDA E T DQ+WR+EFEPFYNG D E +KL EPSSWFSGYDRCNI Sbjct: 1326 EMAKYDAGESHTACDQQWREEFEPFYNGEDSELSKLAEPSSWFSGYDRCNI 1376 >KZM86984.1 hypothetical protein DCAR_024118 [Daucus carota subsp. sativus] Length = 1312 Score = 82.0 bits (201), Expect = 5e-15 Identities = 37/49 (75%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = -2 Query: 515 AKYDAVELD-TTADQRWRDEFEPFYNGDEESTKLVEPSSWFSGYDRCNI 372 AKYD VELD TTADQ WRDEF+PFYN ++ES++L EP SWFSGYDRCN+ Sbjct: 1265 AKYDVVELDPTTADQHWRDEFKPFYNSEDESSRLAEP-SWFSGYDRCNV 1312 >XP_008337488.1 PREDICTED: kinesin-like protein KIN12B [Malus domestica] Length = 1324 Score = 81.6 bits (200), Expect = 7e-15 Identities = 37/51 (72%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNGDE-ESTKLVEPSSWFSGYDRCNI 372 +MAKYDA E + +DQRWR+EFEPFYNG+E E KL +PSSWFSGYDRCNI Sbjct: 1274 NMAKYDAGEPHSLSDQRWREEFEPFYNGEEGELRKLAQPSSWFSGYDRCNI 1324 >XP_009373611.1 PREDICTED: kinesin-like protein KIN-12B [Pyrus x bretschneideri] Length = 1325 Score = 81.6 bits (200), Expect = 7e-15 Identities = 37/51 (72%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNGDE-ESTKLVEPSSWFSGYDRCNI 372 +MAKYDA E + +DQRWR+EFEPFYNG+E E KL +PSSWFSGYDRCNI Sbjct: 1275 NMAKYDAGEPHSLSDQRWREEFEPFYNGEEGELRKLAQPSSWFSGYDRCNI 1325 >XP_009371095.1 PREDICTED: kinesin-like protein KIN-12B [Pyrus x bretschneideri] Length = 1325 Score = 81.6 bits (200), Expect = 7e-15 Identities = 37/51 (72%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNGDE-ESTKLVEPSSWFSGYDRCNI 372 +MAKYDA E + +DQRWR+EFEPFYNG+E E KL +PSSWFSGYDRCNI Sbjct: 1275 NMAKYDAGEPHSLSDQRWREEFEPFYNGEEGELRKLAQPSSWFSGYDRCNI 1325 >EOY05083.1 Phragmoplast-associated kinesin-related protein, putative isoform 3 [Theobroma cacao] Length = 1206 Score = 78.2 bits (191), Expect = 1e-13 Identities = 37/51 (72%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 D AKYDA E +DQRWR+EFEPFYNG D E +KL E SSWFSGYDRCNI Sbjct: 1156 DNAKYDAGETHYASDQRWREEFEPFYNGEDGELSKLAENSSWFSGYDRCNI 1206 >XP_017975859.1 PREDICTED: kinesin-like protein KIN12B [Theobroma cacao] Length = 1264 Score = 78.2 bits (191), Expect = 1e-13 Identities = 37/51 (72%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 D AKYDA E +DQRWR+EFEPFYNG D E +KL E SSWFSGYDRCNI Sbjct: 1214 DNAKYDAGETHYASDQRWREEFEPFYNGEDGELSKLAENSSWFSGYDRCNI 1264 >EOY05081.1 Phragmoplast-associated kinesin-related protein, putative isoform 1 [Theobroma cacao] Length = 1264 Score = 78.2 bits (191), Expect = 1e-13 Identities = 37/51 (72%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 D AKYDA E +DQRWR+EFEPFYNG D E +KL E SSWFSGYDRCNI Sbjct: 1214 DNAKYDAGETHYASDQRWREEFEPFYNGEDGELSKLAENSSWFSGYDRCNI 1264 >XP_009378163.1 PREDICTED: kinesin-like protein KIN-12B [Pyrus x bretschneideri] Length = 1327 Score = 78.2 bits (191), Expect = 1e-13 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNGDE-ESTKLVEPSSWFSGYDRCNI 372 +MAKYDA E + +DQRWR+EFEPFY G+E E KL EPS WFSGYDRCNI Sbjct: 1277 NMAKYDAGEPHSLSDQRWREEFEPFYKGEEGELRKLAEPSLWFSGYDRCNI 1327 >XP_010093879.1 Kinesin-like protein KIF15 [Morus notabilis] EXB54784.1 Kinesin-like protein KIF15 [Morus notabilis] Length = 1345 Score = 77.4 bits (189), Expect = 2e-13 Identities = 36/51 (70%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 DMAKY+ E +DQ+WR+EFEPFYNG D E KL EPSSWFSGYDRCNI Sbjct: 1295 DMAKYNIEEPCDASDQQWREEFEPFYNGEDGELPKLAEPSSWFSGYDRCNI 1345 >OMO75912.1 hypothetical protein CCACVL1_15994 [Corchorus capsularis] Length = 1246 Score = 76.6 bits (187), Expect = 4e-13 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 D+AKYD E +DQRWR+EFEPFYNG D E +KL + SSWFSGYDRCNI Sbjct: 1196 DIAKYDVGENHDDSDQRWREEFEPFYNGEDSELSKLADNSSWFSGYDRCNI 1246 >XP_011462843.1 PREDICTED: kinesin-like protein KIN12B [Fragaria vesca subsp. vesca] Length = 1319 Score = 76.6 bits (187), Expect = 4e-13 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -2 Query: 518 MAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 +AKYD E + +DQRW++EFEPFYNG D E KL EPSSWFSGYDRCNI Sbjct: 1270 VAKYDLGEPHSLSDQRWKEEFEPFYNGEDGELRKLAEPSSWFSGYDRCNI 1319 >XP_007225458.1 hypothetical protein PRUPE_ppa000288mg [Prunus persica] ONI28976.1 hypothetical protein PRUPE_1G173100 [Prunus persica] Length = 1340 Score = 76.6 bits (187), Expect = 4e-13 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -2 Query: 518 MAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 M KYD E + +DQRW++EFEPFYNG D E KL EPSSWFSGYDRCNI Sbjct: 1291 MPKYDVGEPHSLSDQRWKEEFEPFYNGEDGELRKLTEPSSWFSGYDRCNI 1340 >XP_018828254.1 PREDICTED: kinesin-like protein KIN-12B isoform X2 [Juglans regia] Length = 1341 Score = 76.6 bits (187), Expect = 4e-13 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -2 Query: 518 MAKYDAVELDTTADQRWRDEFEPFYNGDE-ESTKLVEPSSWFSGYDRCNI 372 +A YDA E ++DQRWR+EFEPFYNG+E E K EPSSWFSGYDRCNI Sbjct: 1292 IATYDAGETRNSSDQRWREEFEPFYNGEEGELPKPTEPSSWFSGYDRCNI 1341 >XP_018828253.1 PREDICTED: kinesin-like protein KIN-12B isoform X1 [Juglans regia] Length = 1343 Score = 76.6 bits (187), Expect = 4e-13 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -2 Query: 518 MAKYDAVELDTTADQRWRDEFEPFYNGDE-ESTKLVEPSSWFSGYDRCNI 372 +A YDA E ++DQRWR+EFEPFYNG+E E K EPSSWFSGYDRCNI Sbjct: 1294 IATYDAGETRNSSDQRWREEFEPFYNGEEGELPKPTEPSSWFSGYDRCNI 1343 >XP_011011106.1 PREDICTED: kinesin-like protein KIN12B isoform X2 [Populus euphratica] Length = 1181 Score = 76.3 bits (186), Expect = 5e-13 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 3/53 (5%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYN---GDEESTKLVEPSSWFSGYDRCNI 372 DM KYDA E + D+RWR+EFEPFYN G+ E +KL EPS+WFSGYDRCNI Sbjct: 1129 DMPKYDAGEPLSEGDERWREEFEPFYNVEDGEGELSKLAEPSAWFSGYDRCNI 1181 >XP_011011105.1 PREDICTED: kinesin-like protein KIN12B isoform X1 [Populus euphratica] Length = 1289 Score = 76.3 bits (186), Expect = 5e-13 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 3/53 (5%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYN---GDEESTKLVEPSSWFSGYDRCNI 372 DM KYDA E + D+RWR+EFEPFYN G+ E +KL EPS+WFSGYDRCNI Sbjct: 1237 DMPKYDAGEPLSEGDERWREEFEPFYNVEDGEGELSKLAEPSAWFSGYDRCNI 1289 >XP_002303008.1 PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED protein 1 [Populus trichocarpa] EEE82281.1 PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED protein 1 [Populus trichocarpa] Length = 1294 Score = 76.3 bits (186), Expect = 5e-13 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 3/53 (5%) Frame = -2 Query: 521 DMAKYDAVELDTTADQRWRDEFEPFYN---GDEESTKLVEPSSWFSGYDRCNI 372 DM KYDA E + D+RWR+EFEPFYN G+ E +KL EPS+WFSGYDRCNI Sbjct: 1242 DMPKYDAGEPLSEGDERWREEFEPFYNVEDGEGELSKLAEPSAWFSGYDRCNI 1294 >XP_008222786.1 PREDICTED: kinesin-like protein KIN12B [Prunus mume] Length = 1329 Score = 76.3 bits (186), Expect = 5e-13 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -2 Query: 518 MAKYDAVELDTTADQRWRDEFEPFYNG-DEESTKLVEPSSWFSGYDRCNI 372 M KYD E + +DQRW++EFEPFYNG D E KL EPSSWFSGYDRCNI Sbjct: 1280 MPKYDVGEPRSLSDQRWKEEFEPFYNGEDGELRKLTEPSSWFSGYDRCNI 1329