BLASTX nr result
ID: Panax24_contig00035445
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00035445 (509 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002322815.1 hypothetical protein POPTR_0016s07700g [Populus t... 59 8e-09 XP_002310048.1 hypothetical protein POPTR_0007s07030g [Populus t... 53 1e-06 AFK44928.1 unknown [Medicago truncatula] 52 4e-06 >XP_002322815.1 hypothetical protein POPTR_0016s07700g [Populus trichocarpa] EEF04576.1 hypothetical protein POPTR_0016s07700g [Populus trichocarpa] Length = 63 Score = 58.9 bits (141), Expect = 8e-09 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +2 Query: 356 LFLRNIRSGRLRSFAFARLERLCCFILPWMSEILFFYFYFAL 481 L +NIRSGRLR+FAFA LE LCCFILPWMSE +F L Sbjct: 19 LVSQNIRSGRLRAFAFAGLESLCCFILPWMSETSILNEFFGL 60 >XP_002310048.1 hypothetical protein POPTR_0007s07030g [Populus trichocarpa] EEE90498.1 hypothetical protein POPTR_0007s07030g [Populus trichocarpa] Length = 64 Score = 53.1 bits (126), Expect = 1e-06 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +2 Query: 332 VDDDKF*GLFLRNIRSGRLRSFAF-ARLERLCCFILPWMSEILFFYFYFA 478 V+DD+ GLFL+NIRSGRLR+FAF RLE CC I P + ++ F YFA Sbjct: 8 VNDDRSKGLFLKNIRSGRLRAFAFRPRLESFCC-IFPSLDSLIQFCDYFA 56 >AFK44928.1 unknown [Medicago truncatula] Length = 57 Score = 51.6 bits (122), Expect = 4e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 453 ISDIQGRIKQHNLSSLAKAKDLRRPLRMF 367 + DIQGRIKQH LSSLAKAK LRRPLRMF Sbjct: 29 VPDIQGRIKQHKLSSLAKAKVLRRPLRMF 57