BLASTX nr result
ID: Panax24_contig00035302
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00035302 (525 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF33868.1 conserved hypothetical protein [Ricinus communis] 52 9e-06 >EEF33868.1 conserved hypothetical protein [Ricinus communis] Length = 81 Score = 51.6 bits (122), Expect = 9e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 524 EECDSSRFKSYLASSLDCKIPSLEFTLGRP 435 +EC+S+R K YL S+LDCK PSLEFTLGRP Sbjct: 45 QECNSNRMKGYLGSNLDCKNPSLEFTLGRP 74