BLASTX nr result
ID: Panax24_contig00035239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00035239 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017256526.1 PREDICTED: putative B3 domain-containing protein ... 58 1e-07 XP_017256383.1 PREDICTED: B3 domain-containing protein At2g33720... 58 1e-07 XP_017228470.1 PREDICTED: B3 domain-containing protein At2g33720... 58 1e-07 XP_017256525.1 PREDICTED: putative B3 domain-containing protein ... 57 4e-07 >XP_017256526.1 PREDICTED: putative B3 domain-containing protein At1g78640 [Daucus carota subsp. sativus] KZM90709.1 hypothetical protein DCAR_021926 [Daucus carota subsp. sativus] Length = 228 Score = 58.2 bits (139), Expect = 1e-07 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 12/72 (16%) Frame = +2 Query: 203 PKKSPED----IRVAKKLRSFRVYSH-EED*EKIMGVSTKIKLF-------DDPCKIRKF 346 PKKS + +R+AK + FR Y+ EE+ EKI+GVSTK+ L+ DDP KI+K Sbjct: 48 PKKSTYECVMNMRIAKNISGFRFYTRDEEEEEKILGVSTKLSLWIDGDESGDDPWKIKKT 107 Query: 347 LTTSDCNHLYRL 382 L SDC+HL RL Sbjct: 108 LEQSDCDHLCRL 119 >XP_017256383.1 PREDICTED: B3 domain-containing protein At2g33720-like [Daucus carota subsp. sativus] KZM90127.1 hypothetical protein DCAR_022508 [Daucus carota subsp. sativus] Length = 231 Score = 58.2 bits (139), Expect = 1e-07 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 7/61 (11%) Frame = +2 Query: 221 DIRVAKKLRSFRVYSHEED*-EKIMGVSTKIKLF------DDPCKIRKFLTTSDCNHLYR 379 +IR+AK + FR Y+HEE+ E+ +GVSTK+KL+ +DP KI+K L SDC+ LYR Sbjct: 60 NIRIAKNISGFRSYTHEEEARERFLGVSTKLKLWIDGSEGNDPWKIKKTLKHSDCDRLYR 119 Query: 380 L 382 L Sbjct: 120 L 120 >XP_017228470.1 PREDICTED: B3 domain-containing protein At2g33720-like [Daucus carota subsp. sativus] KZM80307.1 hypothetical protein DCAR_031897 [Daucus carota subsp. sativus] Length = 231 Score = 58.2 bits (139), Expect = 1e-07 Identities = 31/61 (50%), Positives = 43/61 (70%), Gaps = 7/61 (11%) Frame = +2 Query: 221 DIRVAKKLRSFRVYSHEED*-EKIMGVSTKIKLF------DDPCKIRKFLTTSDCNHLYR 379 +IR+AK + FR Y+HEE+ E+ +GVSTK+KL+ +DP KI+K L SDC+ LYR Sbjct: 60 NIRIAKNISGFRSYTHEEEARERFLGVSTKLKLWIDGSEGNDPWKIKKTLKHSDCDRLYR 119 Query: 380 L 382 L Sbjct: 120 L 120 >XP_017256525.1 PREDICTED: putative B3 domain-containing protein At1g78640 [Daucus carota subsp. sativus] KZM90708.1 hypothetical protein DCAR_021927 [Daucus carota subsp. sativus] Length = 230 Score = 56.6 bits (135), Expect = 4e-07 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 12/72 (16%) Frame = +2 Query: 203 PKKSPED----IRVAKKLRSFRVYSHEED*E-KIMGVSTKIKLF-------DDPCKIRKF 346 PKKS + +R+AK +R FR Y+ EE+ E + +GVSTK+ L DDP KI+K Sbjct: 48 PKKSTYECVMNMRIAKNIRGFRFYTREEEEEERFLGVSTKLSLSVDGNESGDDPWKIKKT 107 Query: 347 LTTSDCNHLYRL 382 L SDC+HL RL Sbjct: 108 LEQSDCDHLCRL 119