BLASTX nr result
ID: Panax24_contig00035173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00035173 (862 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006340722.1 PREDICTED: zinc finger CCCH domain-containing pro... 58 8e-06 >XP_006340722.1 PREDICTED: zinc finger CCCH domain-containing protein 68 [Solanum tuberosum] Length = 599 Score = 57.8 bits (138), Expect = 8e-06 Identities = 42/127 (33%), Positives = 63/127 (49%), Gaps = 10/127 (7%) Frame = -2 Query: 615 KHKDEGSLIDTNLLMLFLNNPEIVPKLISE--LGASANTGSKT-----ASMPNEVKSSFS 457 K +++ SLIDTNLL+ L NP+ +PKL+++ L +A TG+ T A+M V Sbjct: 307 KSQEQDSLIDTNLLVRLLLNPKEIPKLMNDHGLATNAKTGAATIDSLVAAMSRPVDLPVP 366 Query: 456 LPSSKFDQVMKLSTNEHGVRSKIGVHISEPKAM---TPVSFSSSKPELKMKFKNTHEPPP 286 LP +K D+V+ NE+ I PK M P++ + + +K N PP Sbjct: 367 LPRTKPDKVIIKPINEYQAPHAGSGPIFGPKPMAKSVPLTMTKPETSVKSNLVNEQRAPP 426 Query: 285 RVATIPI 265 V T I Sbjct: 427 HVGTANI 433