BLASTX nr result
ID: Panax24_contig00035148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00035148 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002297807.2 hypothetical protein POPTR_0001s14660g [Populus t... 87 1e-17 XP_011034492.1 PREDICTED: pleiotropic drug resistance protein 1-... 86 3e-17 XP_010459090.1 PREDICTED: ABC transporter G family member 40 iso... 86 6e-17 XP_002892871.1 ATPDR12/PDR12 [Arabidopsis lyrata subsp. lyrata] ... 86 6e-17 XP_010476642.1 PREDICTED: ABC transporter G family member 40-lik... 86 6e-17 XP_010459089.1 PREDICTED: ABC transporter G family member 40 iso... 86 6e-17 XP_010497221.1 PREDICTED: ABC transporter G family member 40 [Ca... 86 6e-17 BAR94044.1 PDR-type ACB transporter [Nicotiana benthamiana] 86 6e-17 XP_010459091.1 PREDICTED: ABC transporter G family member 40 iso... 86 6e-17 XP_016566100.1 PREDICTED: pleiotropic drug resistance protein 1 ... 85 8e-17 XP_018855375.1 PREDICTED: pleiotropic drug resistance protein 1-... 79 1e-16 XP_011020655.1 PREDICTED: pleiotropic drug resistance protein 1-... 85 1e-16 KVH90323.1 AAA+ ATPase domain-containing protein [Cynara cardunc... 84 2e-16 XP_002297805.2 hypothetical protein POPTR_0001s14630g [Populus t... 84 2e-16 KVG06349.1 AAA+ ATPase domain-containing protein [Cynara cardunc... 84 2e-16 XP_019233701.1 PREDICTED: pleiotropic drug resistance protein 1 ... 84 2e-16 XP_009799502.1 PREDICTED: pleiotropic drug resistance protein 1 ... 84 2e-16 KRH09798.1 hypothetical protein GLYMA_15G012000 [Glycine max] 84 3e-16 OAY63326.1 ABC transporter G family member 36 [Ananas comosus] 84 3e-16 KHN22481.1 Pleiotropic drug resistance protein 1 [Glycine soja] 84 3e-16 >XP_002297807.2 hypothetical protein POPTR_0001s14660g [Populus trichocarpa] EEE82612.2 hypothetical protein POPTR_0001s14660g [Populus trichocarpa] Length = 1449 Score = 87.4 bits (215), Expect = 1e-17 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QVL+E+PYIFVQA VYG+IVY++IGFEWTVVKFFWYLFFMY Sbjct: 1274 PYAFAQVLIELPYIFVQAAVYGIIVYAMIGFEWTVVKFFWYLFFMY 1319 >XP_011034492.1 PREDICTED: pleiotropic drug resistance protein 1-like [Populus euphratica] XP_011034493.1 PREDICTED: pleiotropic drug resistance protein 1-like [Populus euphratica] Length = 1449 Score = 86.3 bits (212), Expect = 3e-17 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV++E+PYIFVQA VYG+IVY++IGFEWTVVKFFWYLFFMY Sbjct: 1274 PYAFAQVVIELPYIFVQAAVYGIIVYAMIGFEWTVVKFFWYLFFMY 1319 >XP_010459090.1 PREDICTED: ABC transporter G family member 40 isoform X2 [Camelina sativa] Length = 1161 Score = 85.5 bits (210), Expect = 6e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV +EIPY+FVQAVVYG+IVY++IGFEWT VKFFWYLFFMY Sbjct: 986 PYAFAQVFIEIPYVFVQAVVYGLIVYAMIGFEWTAVKFFWYLFFMY 1031 >XP_002892871.1 ATPDR12/PDR12 [Arabidopsis lyrata subsp. lyrata] EFH69130.1 ATPDR12/PDR12 [Arabidopsis lyrata subsp. lyrata] Length = 1422 Score = 85.5 bits (210), Expect = 6e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV +EIPY+FVQAVVYG+IVY++IGFEWT VKFFWYLFFMY Sbjct: 1247 PYAFAQVFIEIPYVFVQAVVYGLIVYAMIGFEWTAVKFFWYLFFMY 1292 >XP_010476642.1 PREDICTED: ABC transporter G family member 40-like [Camelina sativa] Length = 1424 Score = 85.5 bits (210), Expect = 6e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV +EIPY+FVQAVVYG+IVY++IGFEWT VKFFWYLFFMY Sbjct: 1249 PYAFAQVFIEIPYVFVQAVVYGLIVYAMIGFEWTAVKFFWYLFFMY 1294 >XP_010459089.1 PREDICTED: ABC transporter G family member 40 isoform X1 [Camelina sativa] Length = 1424 Score = 85.5 bits (210), Expect = 6e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV +EIPY+FVQAVVYG+IVY++IGFEWT VKFFWYLFFMY Sbjct: 1249 PYAFAQVFIEIPYVFVQAVVYGLIVYAMIGFEWTAVKFFWYLFFMY 1294 >XP_010497221.1 PREDICTED: ABC transporter G family member 40 [Camelina sativa] Length = 1424 Score = 85.5 bits (210), Expect = 6e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV +EIPY+FVQAVVYG+IVY++IGFEWT VKFFWYLFFMY Sbjct: 1249 PYAFAQVFIEIPYVFVQAVVYGLIVYAMIGFEWTAVKFFWYLFFMY 1294 >BAR94044.1 PDR-type ACB transporter [Nicotiana benthamiana] Length = 1433 Score = 85.5 bits (210), Expect = 6e-17 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QVL+EIPYIFVQAVVYG+IVYS+IGFEWTV KFFWY FFM+ Sbjct: 1257 PYAFAQVLIEIPYIFVQAVVYGLIVYSMIGFEWTVAKFFWYFFFMF 1302 >XP_010459091.1 PREDICTED: ABC transporter G family member 40 isoform X3 [Camelina sativa] Length = 1436 Score = 85.5 bits (210), Expect = 6e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV +EIPY+FVQAVVYG+IVY++IGFEWT VKFFWYLFFMY Sbjct: 1261 PYAFAQVFIEIPYVFVQAVVYGLIVYAMIGFEWTAVKFFWYLFFMY 1306 >XP_016566100.1 PREDICTED: pleiotropic drug resistance protein 1 [Capsicum annuum] Length = 1433 Score = 85.1 bits (209), Expect = 8e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QVL+EIPY+FVQAVVYG+IVYS+IGFEWTV KFFWY FFM+ Sbjct: 1259 PYAFAQVLIEIPYVFVQAVVYGLIVYSMIGFEWTVAKFFWYFFFMF 1304 >XP_018855375.1 PREDICTED: pleiotropic drug resistance protein 1-like, partial [Juglans regia] Length = 119 Score = 79.3 bits (194), Expect = 1e-16 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV +EIPYIF+Q+ VYG+IVYS+IGFEWT KFFWYLFFM+ Sbjct: 61 PYAFGQVAIEIPYIFMQSAVYGIIVYSMIGFEWTAAKFFWYLFFMF 106 >XP_011020655.1 PREDICTED: pleiotropic drug resistance protein 1-like [Populus euphratica] Length = 1449 Score = 84.7 bits (208), Expect = 1e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F Q L+E+PYIFVQA VYGVIVY++IGFEWTV KFFWYLFFMY Sbjct: 1274 PYAFAQALIELPYIFVQAAVYGVIVYAMIGFEWTVAKFFWYLFFMY 1319 >KVH90323.1 AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 1408 Score = 84.3 bits (207), Expect = 2e-16 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV++EIPYIFVQ +VYG+IVY++IGFEWT VKFFWYLFFMY Sbjct: 1233 PYAFGQVMIEIPYIFVQTIVYGIIVYAMIGFEWTAVKFFWYLFFMY 1278 >XP_002297805.2 hypothetical protein POPTR_0001s14630g [Populus trichocarpa] EEE82610.2 hypothetical protein POPTR_0001s14630g [Populus trichocarpa] Length = 1407 Score = 84.0 bits (206), Expect = 2e-16 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QVL+EIPY+FVQ+ VYGVIVY++IGFEWT KFFWYLFFMY Sbjct: 1232 PYAFAQVLIEIPYVFVQSAVYGVIVYAMIGFEWTAAKFFWYLFFMY 1277 >KVG06349.1 AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 1428 Score = 84.0 bits (206), Expect = 2e-16 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F Q+++E+PYIFVQ +VYG+IVY++IGFEWT+VKFFWYLFFMY Sbjct: 1253 PYAFGQIMIEVPYIFVQTIVYGIIVYAMIGFEWTLVKFFWYLFFMY 1298 >XP_019233701.1 PREDICTED: pleiotropic drug resistance protein 1 [Nicotiana attenuata] OIT06816.1 pleiotropic drug resistance protein 1 [Nicotiana attenuata] Length = 1436 Score = 84.0 bits (206), Expect = 2e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QVL+EIPYIFVQA VYG+IVYS+IGFEWTV KFFWY FFM+ Sbjct: 1260 PYAFAQVLIEIPYIFVQATVYGLIVYSMIGFEWTVAKFFWYFFFMF 1305 >XP_009799502.1 PREDICTED: pleiotropic drug resistance protein 1 [Nicotiana sylvestris] XP_016478141.1 PREDICTED: pleiotropic drug resistance protein 1 [Nicotiana tabacum] Length = 1437 Score = 84.0 bits (206), Expect = 2e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QVL+EIPYIFVQA VYG+IVYS+IGFEWTV KFFWY FFM+ Sbjct: 1261 PYAFAQVLIEIPYIFVQATVYGLIVYSMIGFEWTVAKFFWYFFFMF 1306 >KRH09798.1 hypothetical protein GLYMA_15G012000 [Glycine max] Length = 1142 Score = 83.6 bits (205), Expect = 3e-16 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F Q+LVE+PY+FVQAV YGVIVY++IGFEWT KFFWYLFFMY Sbjct: 965 PYAFAQILVELPYVFVQAVTYGVIVYAMIGFEWTAEKFFWYLFFMY 1010 >OAY63326.1 ABC transporter G family member 36 [Ananas comosus] Length = 1384 Score = 83.6 bits (205), Expect = 3e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F QV +EIPYIFVQAV+YGVIVY++IGFEWT KFFWYLFFMY Sbjct: 1209 PYAFGQVAIEIPYIFVQAVIYGVIVYAMIGFEWTAAKFFWYLFFMY 1254 >KHN22481.1 Pleiotropic drug resistance protein 1 [Glycine soja] Length = 1427 Score = 83.6 bits (205), Expect = 3e-16 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 140 PALFLQVLVEIPYIFVQAVVYGVIVYSLIGFEWTVVKFFWYLFFMY 3 P F Q+LVE+PY+FVQAV YGVIVY++IGFEWT KFFWYLFFMY Sbjct: 1250 PYAFAQILVELPYVFVQAVTYGVIVYAMIGFEWTAEKFFWYLFFMY 1295