BLASTX nr result
ID: Panax24_contig00035117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00035117 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017222748.1 PREDICTED: uncharacterized protein LOC108199448 i... 54 6e-06 KZM83882.1 hypothetical protein DCAR_028696 [Daucus carota subsp... 54 7e-06 XP_017222747.1 PREDICTED: RNA-binding protein EWS isoform X1 [Da... 54 7e-06 >XP_017222748.1 PREDICTED: uncharacterized protein LOC108199448 isoform X2 [Daucus carota subsp. sativus] XP_017222749.1 PREDICTED: uncharacterized protein LOC108199448 isoform X2 [Daucus carota subsp. sativus] Length = 353 Score = 53.5 bits (127), Expect = 6e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 351 GYRMRAGSASPVRRRAADRHYSPEFDHTGG 262 GYR+RAGSASPVRRR +R YSPEFDH G Sbjct: 18 GYRVRAGSASPVRRRTTERRYSPEFDHQNG 47 >KZM83882.1 hypothetical protein DCAR_028696 [Daucus carota subsp. sativus] Length = 382 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 351 GYRMRAGSASPVRRRAADRHYSPEFDHTGG 262 GYR+RAGSASPVRRR +R YSPEFDH G Sbjct: 47 GYRVRAGSASPVRRRTTERRYSPEFDHQNG 76 >XP_017222747.1 PREDICTED: RNA-binding protein EWS isoform X1 [Daucus carota subsp. sativus] Length = 391 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 351 GYRMRAGSASPVRRRAADRHYSPEFDHTGG 262 GYR+RAGSASPVRRR +R YSPEFDH G Sbjct: 56 GYRVRAGSASPVRRRTTERRYSPEFDHQNG 85