BLASTX nr result
ID: Panax24_contig00034908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00034908 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN11484.1 hypothetical protein DCAR_004140 [Daucus carota subsp... 117 3e-29 CBI23303.3 unnamed protein product, partial [Vitis vinifera] 119 5e-29 XP_002271412.2 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 119 5e-29 CAN66468.1 hypothetical protein VITISV_016565 [Vitis vinifera] 119 6e-29 XP_008439908.1 PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [... 117 3e-28 XP_017229520.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 117 3e-28 XP_016444588.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 115 3e-28 XP_002305651.1 hypothetical protein POPTR_0004s03400g [Populus t... 116 7e-28 XP_004134961.1 PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Cucum... 116 7e-28 XP_011001141.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 116 7e-28 XP_011043308.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 116 7e-28 XP_012455156.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 115 9e-28 KZV36109.1 protein TRANSPORT INHIBITOR RESPONSE 1-like [Dorcocer... 108 1e-27 XP_009603009.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 115 1e-27 CDO99639.1 unnamed protein product [Coffea canephora] 114 2e-27 KVH96935.1 hypothetical protein Ccrd_000972 [Cynara cardunculus ... 114 3e-27 XP_019267381.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 114 5e-27 XP_009763253.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 114 5e-27 XP_007025805.2 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1... 114 5e-27 EOY28427.1 F-box/RNI-like superfamily protein [Theobroma cacao] 114 5e-27 >KZN11484.1 hypothetical protein DCAR_004140 [Daucus carota subsp. sativus] Length = 364 Score = 117 bits (293), Expect = 3e-29 Identities = 51/59 (86%), Positives = 59/59 (100%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLE+VLSLV+SHKDRSS+SLVCKDW+NA+RWSR+++FIGNCYSVSPEIVARRFP Sbjct: 22 PFPDEVLEKVLSLVKSHKDRSSVSLVCKDWYNADRWSRSKIFIGNCYSVSPEIVARRFP 80 >CBI23303.3 unnamed protein product, partial [Vitis vinifera] Length = 553 Score = 119 bits (298), Expect = 5e-29 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLERVL LV+SHKDRSS+SLVCKDW+NAERWSRT VFIGNCYSVSPEIVARRFP Sbjct: 23 PFPDEVLERVLGLVKSHKDRSSVSLVCKDWYNAERWSRTHVFIGNCYSVSPEIVARRFP 81 >XP_002271412.2 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Vitis vinifera] Length = 583 Score = 119 bits (298), Expect = 5e-29 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLERVL LV+SHKDRSS+SLVCKDW+NAERWSRT VFIGNCYSVSPEIVARRFP Sbjct: 20 PFPDEVLERVLGLVKSHKDRSSVSLVCKDWYNAERWSRTHVFIGNCYSVSPEIVARRFP 78 >CAN66468.1 hypothetical protein VITISV_016565 [Vitis vinifera] Length = 620 Score = 119 bits (298), Expect = 6e-29 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLERVL LV+SHKDRSS+SLVCKDW+NAERWSRT VFIGNCYSVSPEIVARRFP Sbjct: 20 PFPDEVLERVLGLVKSHKDRSSVSLVCKDWYNAERWSRTHVFIGNCYSVSPEIVARRFP 78 >XP_008439908.1 PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Cucumis melo] Length = 584 Score = 117 bits (293), Expect = 3e-28 Identities = 54/58 (93%), Positives = 56/58 (96%) Frame = +1 Query: 193 FPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 FPDEVLERVLSLV+SHKDRSS+SLVCKDWFNAERWSRT VFIGNCYSVSPEIV RRFP Sbjct: 22 FPDEVLERVLSLVKSHKDRSSVSLVCKDWFNAERWSRTHVFIGNCYSVSPEIVIRRFP 79 >XP_017229520.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Daucus carota subsp. sativus] XP_017229521.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Daucus carota subsp. sativus] XP_017229522.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Daucus carota subsp. sativus] Length = 585 Score = 117 bits (293), Expect = 3e-28 Identities = 51/59 (86%), Positives = 59/59 (100%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLE+VLSLV+SHKDRSS+SLVCKDW+NA+RWSR+++FIGNCYSVSPEIVARRFP Sbjct: 22 PFPDEVLEKVLSLVKSHKDRSSVSLVCKDWYNADRWSRSKIFIGNCYSVSPEIVARRFP 80 >XP_016444588.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like, partial [Nicotiana tabacum] Length = 403 Score = 115 bits (288), Expect = 3e-28 Identities = 51/59 (86%), Positives = 58/59 (98%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLE+VLSLVRSHKDR+S SLVCKDW+NAERW+RT++FIGNCYSVSP+IVARRFP Sbjct: 22 PFPDEVLEKVLSLVRSHKDRNSASLVCKDWYNAERWTRTKLFIGNCYSVSPDIVARRFP 80 >XP_002305651.1 hypothetical protein POPTR_0004s03400g [Populus trichocarpa] EEE86162.1 hypothetical protein POPTR_0004s03400g [Populus trichocarpa] Length = 579 Score = 116 bits (290), Expect = 7e-28 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLERVLSL++SHKDRS++SLVCKDW+NAE WSRT VFIGNCYSVSPEIVARRFP Sbjct: 13 PFPDEVLERVLSLLKSHKDRSAVSLVCKDWYNAESWSRTHVFIGNCYSVSPEIVARRFP 71 >XP_004134961.1 PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Cucumis sativus] KGN49186.1 hypothetical protein Csa_6G516940 [Cucumis sativus] Length = 584 Score = 116 bits (290), Expect = 7e-28 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = +1 Query: 193 FPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 FPDEVLERVLSLV+SH+DRSS+SLVCKDWFNAERWSRT VFIGNCYSVSPEIV RRFP Sbjct: 22 FPDEVLERVLSLVKSHRDRSSVSLVCKDWFNAERWSRTHVFIGNCYSVSPEIVIRRFP 79 >XP_011001141.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Populus euphratica] Length = 585 Score = 116 bits (290), Expect = 7e-28 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLERVLSL++SHKDRS++SLVCKDW+NAE WSRT VFIGNCYSVSPEIVARRFP Sbjct: 19 PFPDEVLERVLSLLKSHKDRSAVSLVCKDWYNAESWSRTHVFIGNCYSVSPEIVARRFP 77 >XP_011043308.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Populus euphratica] Length = 585 Score = 116 bits (290), Expect = 7e-28 Identities = 52/59 (88%), Positives = 57/59 (96%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLERVLSL++SHKDRS++SLVCKDW+NAE WSRT VFIGNCYSVSPEIVARRFP Sbjct: 19 PFPDEVLERVLSLLKSHKDRSAVSLVCKDWYNAESWSRTHVFIGNCYSVSPEIVARRFP 77 >XP_012455156.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Gossypium raimondii] XP_012455157.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Gossypium raimondii] KJB69424.1 hypothetical protein B456_011G023100 [Gossypium raimondii] Length = 586 Score = 115 bits (289), Expect = 9e-28 Identities = 52/58 (89%), Positives = 57/58 (98%) Frame = +1 Query: 193 FPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 FPDEVLERVLSL++SH+DRSS+SLVCKDW+NAERWSRT VFIGNCYSVSPEIVARRFP Sbjct: 24 FPDEVLERVLSLLKSHRDRSSVSLVCKDWYNAERWSRTHVFIGNCYSVSPEIVARRFP 81 >KZV36109.1 protein TRANSPORT INHIBITOR RESPONSE 1-like [Dorcoceras hygrometricum] Length = 159 Score = 108 bits (270), Expect = 1e-27 Identities = 49/59 (83%), Positives = 56/59 (94%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLE+VLSLV SHKDR+S+SLVCK+W+NAERW+RT +FIGN YSVSPEIVARRFP Sbjct: 62 PFPDEVLEKVLSLVDSHKDRNSVSLVCKNWYNAERWTRTNLFIGNYYSVSPEIVARRFP 120 >XP_009603009.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tomentosiformis] XP_009603010.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tomentosiformis] XP_009603011.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tomentosiformis] XP_018626941.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tomentosiformis] Length = 584 Score = 115 bits (288), Expect = 1e-27 Identities = 51/59 (86%), Positives = 58/59 (98%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLE+VLSLVRSHKDR+S SLVCKDW+NAERW+RT++FIGNCYSVSP+IVARRFP Sbjct: 22 PFPDEVLEKVLSLVRSHKDRNSASLVCKDWYNAERWTRTKLFIGNCYSVSPDIVARRFP 80 >CDO99639.1 unnamed protein product [Coffea canephora] Length = 588 Score = 114 bits (286), Expect = 2e-27 Identities = 50/58 (86%), Positives = 57/58 (98%) Frame = +1 Query: 193 FPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 FPDEVLE+VLS++ SHKDRSS+SLVCKDW+NAERWSRT++FIGNCYSVSPEIVARRFP Sbjct: 27 FPDEVLEKVLSMLHSHKDRSSVSLVCKDWYNAERWSRTKIFIGNCYSVSPEIVARRFP 84 >KVH96935.1 hypothetical protein Ccrd_000972 [Cynara cardunculus var. scolymus] Length = 556 Score = 114 bits (285), Expect = 3e-27 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLERVLSL+ SHKDRSS+SLVCKDW+NAERWSR VFIGNCYSVSPEIVA RFP Sbjct: 31 PFPDEVLERVLSLIGSHKDRSSVSLVCKDWYNAERWSRRHVFIGNCYSVSPEIVAARFP 89 >XP_019267381.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana attenuata] XP_019267388.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana attenuata] XP_019267395.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana attenuata] XP_019267401.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana attenuata] OIT05652.1 protein transport inhibitor response 1 [Nicotiana attenuata] Length = 584 Score = 114 bits (284), Expect = 5e-27 Identities = 50/59 (84%), Positives = 58/59 (98%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLE+VLSLV+SHKDR+S SLVCKDW+NAERW+RT++FIGNCYSVSP+IVARRFP Sbjct: 22 PFPDEVLEKVLSLVQSHKDRNSASLVCKDWYNAERWTRTKLFIGNCYSVSPDIVARRFP 80 >XP_009763253.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana sylvestris] XP_009763254.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana sylvestris] XP_009763255.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana sylvestris] XP_009763257.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana sylvestris] XP_016456502.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tabacum] XP_016503122.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tabacum] XP_016503123.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tabacum] XP_016503124.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tabacum] XP_016503126.1 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana tabacum] Length = 584 Score = 114 bits (284), Expect = 5e-27 Identities = 50/59 (84%), Positives = 58/59 (98%) Frame = +1 Query: 190 PFPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 PFPDEVLE+VLSLV+SHKDR+S SLVCKDW+NAERW+RT++FIGNCYSVSP+IVARRFP Sbjct: 22 PFPDEVLEKVLSLVQSHKDRNSASLVCKDWYNAERWTRTKLFIGNCYSVSPDIVARRFP 80 >XP_007025805.2 PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 isoform X1 [Theobroma cacao] Length = 586 Score = 114 bits (284), Expect = 5e-27 Identities = 51/58 (87%), Positives = 56/58 (96%) Frame = +1 Query: 193 FPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 FPDEVLERVLSL++SH+DRSS+SLVCKDW+NAERWSR VFIGNCYSVSPEIVARRFP Sbjct: 24 FPDEVLERVLSLLKSHRDRSSVSLVCKDWYNAERWSRAHVFIGNCYSVSPEIVARRFP 81 >EOY28427.1 F-box/RNI-like superfamily protein [Theobroma cacao] Length = 586 Score = 114 bits (284), Expect = 5e-27 Identities = 51/58 (87%), Positives = 56/58 (96%) Frame = +1 Query: 193 FPDEVLERVLSLVRSHKDRSSISLVCKDWFNAERWSRTRVFIGNCYSVSPEIVARRFP 366 FPDEVLERVLSL++SH+DRSS+SLVCKDW+NAERWSR VFIGNCYSVSPEIVARRFP Sbjct: 24 FPDEVLERVLSLLKSHRDRSSVSLVCKDWYNAERWSRAHVFIGNCYSVSPEIVARRFP 81