BLASTX nr result
ID: Panax24_contig00034387
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00034387 (350 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010241949.1 PREDICTED: glutamate--cysteine ligase, chloroplas... 51 7e-06 >XP_010241949.1 PREDICTED: glutamate--cysteine ligase, chloroplastic-like, partial [Nelumbo nucifera] Length = 102 Score = 50.8 bits (120), Expect = 7e-06 Identities = 25/42 (59%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = +1 Query: 1 GFLGIGFQPKWGIKDIPIMPK---VILNMQMTYTGLLVMHML 117 GFLGIGFQPKWG+KDIPIMPK I+ M G L + M+ Sbjct: 40 GFLGIGFQPKWGLKDIPIMPKGRYEIMRKYMPKVGSLGLDMM 81