BLASTX nr result
ID: Panax24_contig00034289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00034289 (424 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP11656.1 unnamed protein product [Coffea canephora] 57 6e-07 XP_015888436.1 PREDICTED: protein ZINC INDUCED FACILITATOR 1-lik... 55 6e-06 >CDP11656.1 unnamed protein product [Coffea canephora] Length = 504 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/57 (50%), Positives = 37/57 (64%), Gaps = 8/57 (14%) Frame = -1 Query: 202 FSWAQHRRNASILPGDHMVFFI--------LVMTLKPFLAVPTNNL**LRHTAQEDS 56 FSWAQ R+ AS+LPGD MVFFI L+MT KPFL +P +N+ +H E+S Sbjct: 447 FSWAQKRQGASVLPGDQMVFFILNVIEVIGLLMTFKPFLVLPEDNVSNRKHETSEES 503 >XP_015888436.1 PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Ziziphus jujuba] Length = 497 Score = 54.7 bits (130), Expect = 6e-06 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 8/42 (19%) Frame = -1 Query: 202 FSWAQHRRNASILPGDHMVFFI--------LVMTLKPFLAVP 101 FSWAQ R+N S LPGDHMVFFI L+MT KPFLA+P Sbjct: 447 FSWAQKRQNESFLPGDHMVFFILNVIEALGLLMTFKPFLALP 488