BLASTX nr result
ID: Panax24_contig00034228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00034228 (477 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019071061.1 PREDICTED: myb family transcription factor PHL7-l... 70 1e-12 KVI03274.1 Homeodomain-like protein [Cynara cardunculus var. sco... 72 1e-12 XP_017246600.1 PREDICTED: protein PHR1-LIKE 1-like [Daucus carot... 72 3e-12 XP_015159989.1 PREDICTED: protein PHR1-LIKE 1-like [Solanum tube... 68 5e-12 EEF34263.1 hypothetical protein RCOM_0643050 [Ricinus communis] 69 9e-12 KVH94872.1 Homeodomain-like protein, partial [Cynara cardunculus... 70 1e-11 EYU26670.1 hypothetical protein MIMGU_mgv1a019089mg [Erythranthe... 70 1e-11 XP_011077547.1 PREDICTED: protein PHR1-LIKE 1-like [Sesamum indi... 70 2e-11 XP_015580205.1 PREDICTED: transcription repressor KAN1 [Ricinus ... 69 2e-11 XP_015086813.1 PREDICTED: protein PHR1-LIKE 1-like [Solanum penn... 70 2e-11 CDP06476.1 unnamed protein product [Coffea canephora] 70 3e-11 XP_017251064.1 PREDICTED: protein PHR1-LIKE 1-like [Daucus carot... 69 3e-11 OAY41488.1 hypothetical protein MANES_09G105800 [Manihot esculenta] 69 4e-11 XP_016541335.1 PREDICTED: protein PHR1-LIKE 1-like [Capsicum ann... 68 7e-11 CBI22798.3 unnamed protein product, partial [Vitis vinifera] 68 9e-11 XP_002264119.2 PREDICTED: myb family transcription factor PHL7 [... 68 1e-10 XP_017976711.1 PREDICTED: myb family transcription factor PHL7 i... 66 1e-10 XP_002308222.2 hypothetical protein POPTR_0006s10190g [Populus t... 67 1e-10 EOY07190.1 Myb-like HTH transcriptional regulator family protein... 66 2e-10 XP_011019105.1 PREDICTED: protein PHR1-LIKE 1-like isoform X1 [P... 67 2e-10 >XP_019071061.1 PREDICTED: myb family transcription factor PHL7-like [Solanum lycopersicum] Length = 106 Score = 69.7 bits (169), Expect = 1e-12 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSIS 475 KERLKWTQELHDLFEKAV LGG +RATPKGILK M IS Sbjct: 23 KERLKWTQELHDLFEKAVSQLGGPERATPKGILKVMGIS 61 >KVI03274.1 Homeodomain-like protein [Cynara cardunculus var. scolymus] Length = 228 Score = 72.4 bits (176), Expect = 1e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSIS 475 KERLKWTQELHDLFEKAV+ LGG DRATPKGILKAM I+ Sbjct: 12 KERLKWTQELHDLFEKAVNQLGGPDRATPKGILKAMGIT 50 >XP_017246600.1 PREDICTED: protein PHR1-LIKE 1-like [Daucus carota subsp. sativus] Length = 261 Score = 72.0 bits (175), Expect = 3e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERLKWTQELHDLFEKAV+ LGG DRATPKGILKAM I Sbjct: 11 KERLKWTQELHDLFEKAVNQLGGPDRATPKGILKAMGI 48 >XP_015159989.1 PREDICTED: protein PHR1-LIKE 1-like [Solanum tuberosum] Length = 106 Score = 68.2 bits (165), Expect = 5e-12 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERLKWTQELHDLFEKAV LGG +RATPKGILK M I Sbjct: 23 KERLKWTQELHDLFEKAVSQLGGPERATPKGILKVMGI 60 >EEF34263.1 hypothetical protein RCOM_0643050 [Ricinus communis] Length = 164 Score = 68.9 bits (167), Expect = 9e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERL+WTQELHD FE+AV+ LGG DRATPKGILKAMSI Sbjct: 11 KERLRWTQELHDRFERAVNQLGGPDRATPKGILKAMSI 48 >KVH94872.1 Homeodomain-like protein, partial [Cynara cardunculus var. scolymus] Length = 228 Score = 70.1 bits (170), Expect = 1e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSIS 475 KERLKWTQELHDLFEKAV LGG DRATPKGILK M I+ Sbjct: 11 KERLKWTQELHDLFEKAVDQLGGPDRATPKGILKTMGIA 49 >EYU26670.1 hypothetical protein MIMGU_mgv1a019089mg [Erythranthe guttata] Length = 263 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERLKWT+ELHDLFEKAVH +GG DRATP+GIL+AM+I Sbjct: 11 KERLKWTKELHDLFEKAVHQIGGPDRATPRGILRAMAI 48 >XP_011077547.1 PREDICTED: protein PHR1-LIKE 1-like [Sesamum indicum] XP_011077548.1 PREDICTED: protein PHR1-LIKE 1-like [Sesamum indicum] XP_011077549.1 PREDICTED: protein PHR1-LIKE 1-like [Sesamum indicum] XP_011077550.1 PREDICTED: protein PHR1-LIKE 1-like [Sesamum indicum] Length = 262 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERLKWT+ELHDLFEKAV+ +GG DRATPKGILKAM+I Sbjct: 11 KERLKWTKELHDLFEKAVNQIGGPDRATPKGILKAMAI 48 >XP_015580205.1 PREDICTED: transcription repressor KAN1 [Ricinus communis] Length = 203 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERL+WTQELHD FE+AV+ LGG DRATPKGILKAMSI Sbjct: 11 KERLRWTQELHDRFERAVNQLGGPDRATPKGILKAMSI 48 >XP_015086813.1 PREDICTED: protein PHR1-LIKE 1-like [Solanum pennellii] Length = 257 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSIS 475 KERLKWTQELHDLFEKAV LGG +RATPKGILK M IS Sbjct: 23 KERLKWTQELHDLFEKAVSQLGGPERATPKGILKVMGIS 61 >CDP06476.1 unnamed protein product [Coffea canephora] Length = 278 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERLKWTQELH LFEKAV+ LGG DRATPKGILKAM I Sbjct: 36 KERLKWTQELHSLFEKAVNQLGGPDRATPKGILKAMGI 73 >XP_017251064.1 PREDICTED: protein PHR1-LIKE 1-like [Daucus carota subsp. sativus] Length = 220 Score = 68.6 bits (166), Expect = 3e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERLKWTQE+H+LFEKAV LGG DRATPKG+LKAM I Sbjct: 11 KERLKWTQEMHELFEKAVDQLGGPDRATPKGVLKAMGI 48 >OAY41488.1 hypothetical protein MANES_09G105800 [Manihot esculenta] Length = 246 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERL+WTQELHD FE+AV+ LGG DRATPKGILKAMSI Sbjct: 11 KERLRWTQELHDRFERAVNQLGGPDRATPKGILKAMSI 48 >XP_016541335.1 PREDICTED: protein PHR1-LIKE 1-like [Capsicum annuum] Length = 254 Score = 68.2 bits (165), Expect = 7e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERLKWTQELHDLFEKAV LGG +RATPKGILK M I Sbjct: 23 KERLKWTQELHDLFEKAVSQLGGPERATPKGILKVMGI 60 >CBI22798.3 unnamed protein product, partial [Vitis vinifera] Length = 243 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERL+WTQELHD FE+AV+ LGG+DRATPKGILKAM++ Sbjct: 22 KERLRWTQELHDRFEEAVNQLGGADRATPKGILKAMAV 59 >XP_002264119.2 PREDICTED: myb family transcription factor PHL7 [Vitis vinifera] Length = 266 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERL+WTQELHD FE+AV+ LGG+DRATPKGILKAM++ Sbjct: 22 KERLRWTQELHDRFEEAVNQLGGADRATPKGILKAMAV 59 >XP_017976711.1 PREDICTED: myb family transcription factor PHL7 isoform X2 [Theobroma cacao] Length = 165 Score = 65.9 bits (159), Expect = 1e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERL+WTQELHD FE AV+ LGG DRATPKGILKAM + Sbjct: 12 KERLRWTQELHDRFEDAVNQLGGPDRATPKGILKAMGV 49 >XP_002308222.2 hypothetical protein POPTR_0006s10190g [Populus trichocarpa] EEE91745.2 hypothetical protein POPTR_0006s10190g [Populus trichocarpa] Length = 257 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSIS 475 KERL+WTQELHD FE+AV+ LGG DRATPKGIL+AM IS Sbjct: 11 KERLRWTQELHDRFEEAVNQLGGPDRATPKGILRAMGIS 49 >EOY07190.1 Myb-like HTH transcriptional regulator family protein isoform 2 [Theobroma cacao] Length = 179 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSI 472 KERL+WTQELHD FE AV+ LGG DRATPKGILKAM + Sbjct: 12 KERLRWTQELHDRFEDAVNQLGGPDRATPKGILKAMGV 49 >XP_011019105.1 PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Populus euphratica] Length = 257 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 359 KERLKWTQELHDLFEKAVHTLGGSDRATPKGILKAMSIS 475 KERL+WTQELHD FE+AV+ LGG DRATPKG+L+AM IS Sbjct: 11 KERLRWTQELHDRFEEAVNQLGGPDRATPKGVLRAMGIS 49