BLASTX nr result
ID: Panax24_contig00034151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00034151 (1028 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017253459.1 PREDICTED: pentatricopeptide repeat-containing pr... 184 2e-49 XP_017253456.1 PREDICTED: pentatricopeptide repeat-containing pr... 184 1e-48 KZM93691.1 hypothetical protein DCAR_016936 [Daucus carota subsp... 184 3e-48 XP_002265138.1 PREDICTED: pentatricopeptide repeat-containing pr... 180 3e-47 CAN67593.1 hypothetical protein VITISV_000699 [Vitis vinifera] 178 1e-46 ONI17874.1 hypothetical protein PRUPE_3G184500 [Prunus persica] 168 7e-43 XP_008229634.1 PREDICTED: pentatricopeptide repeat-containing pr... 167 2e-42 CAN74489.1 hypothetical protein VITISV_029273 [Vitis vinifera] 147 1e-40 XP_008365185.1 PREDICTED: pentatricopeptide repeat-containing pr... 159 1e-39 XP_009350666.1 PREDICTED: pentatricopeptide repeat-containing pr... 158 2e-39 XP_011654005.1 PREDICTED: pentatricopeptide repeat-containing pr... 154 7e-38 XP_006576131.1 PREDICTED: pentatricopeptide repeat-containing pr... 153 1e-37 KHN29870.1 Pentatricopeptide repeat-containing protein, chloropl... 153 1e-37 XP_007216509.1 hypothetical protein PRUPE_ppa025580mg, partial [... 153 1e-37 XP_015970900.1 PREDICTED: pentatricopeptide repeat-containing pr... 152 2e-37 XP_012568696.1 PREDICTED: pentatricopeptide repeat-containing pr... 152 2e-37 XP_008464638.1 PREDICTED: pentatricopeptide repeat-containing pr... 152 3e-37 XP_003618091.1 PPR containing plant-like protein [Medicago trunc... 151 4e-37 XP_019264789.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 1e-36 XP_018632863.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 1e-36 >XP_017253459.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic isoform X3 [Daucus carota subsp. sativus] XP_017253460.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic isoform X4 [Daucus carota subsp. sativus] Length = 652 Score = 184 bits (467), Expect = 2e-49 Identities = 86/110 (78%), Positives = 94/110 (85%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CRTHGEFQLG+IVA KF E+EK N+M+GYHVLLSNI+AEEGNWESVN VREGM KGL K Sbjct: 542 CRTHGEFQLGRIVAKKFYEIEKMNNMSGYHVLLSNIYAEEGNWESVNGVREGMQEKGLSK 601 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVE 331 EVGCSWI++AGY+N F SRDQKHPQSD IY LEELGI M DAGYRP E Sbjct: 602 EVGCSWIDVAGYINYFVSRDQKHPQSDSIYTSLEELGINMKDAGYRPSTE 651 >XP_017253456.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic isoform X1 [Daucus carota subsp. sativus] XP_017253457.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic isoform X2 [Daucus carota subsp. sativus] XP_017253458.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic isoform X1 [Daucus carota subsp. sativus] Length = 812 Score = 184 bits (467), Expect = 1e-48 Identities = 86/110 (78%), Positives = 94/110 (85%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CRTHGEFQLG+IVA KF E+EK N+M+GYHVLLSNI+AEEGNWESVN VREGM KGL K Sbjct: 702 CRTHGEFQLGRIVAKKFYEIEKMNNMSGYHVLLSNIYAEEGNWESVNGVREGMQEKGLSK 761 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVE 331 EVGCSWI++AGY+N F SRDQKHPQSD IY LEELGI M DAGYRP E Sbjct: 762 EVGCSWIDVAGYINYFVSRDQKHPQSDSIYTSLEELGINMKDAGYRPSTE 811 >KZM93691.1 hypothetical protein DCAR_016936 [Daucus carota subsp. sativus] Length = 1064 Score = 184 bits (467), Expect = 3e-48 Identities = 86/110 (78%), Positives = 94/110 (85%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CRTHGEFQLG+IVA KF E+EK N+M+GYHVLLSNI+AEEGNWESVN VREGM KGL K Sbjct: 954 CRTHGEFQLGRIVAKKFYEIEKMNNMSGYHVLLSNIYAEEGNWESVNGVREGMQEKGLSK 1013 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVE 331 EVGCSWI++AGY+N F SRDQKHPQSD IY LEELGI M DAGYRP E Sbjct: 1014 EVGCSWIDVAGYINYFVSRDQKHPQSDSIYTSLEELGINMKDAGYRPSTE 1063 >XP_002265138.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Vitis vinifera] Length = 825 Score = 180 bits (457), Expect = 3e-47 Identities = 80/121 (66%), Positives = 100/121 (82%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR HGEF+LGK+VANK LEMEKG+S+TGYHVLLSNI+A EGNW++V+RVR+ M KGL+K Sbjct: 705 CRIHGEFELGKVVANKLLEMEKGSSLTGYHVLLSNIYAAEGNWDNVDRVRKEMRQKGLMK 764 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E GCSW+ +AG+VNCF SRD KHPQ +IY+MLE+L + M DAGY+PC+ Q G + SE Sbjct: 765 EAGCSWVEVAGHVNCFMSRDHKHPQCAEIYQMLEKLAMEMKDAGYKPCLNLQTGGISASE 824 Query: 362 E 364 E Sbjct: 825 E 825 >CAN67593.1 hypothetical protein VITISV_000699 [Vitis vinifera] Length = 825 Score = 178 bits (452), Expect = 1e-46 Identities = 79/121 (65%), Positives = 99/121 (81%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR HGEF+LGK+VANK LEMEKG+ +TGYHVLLSNI+A EGNW++V+RVR+ M KGL+K Sbjct: 705 CRIHGEFELGKVVANKLLEMEKGSXLTGYHVLLSNIYAAEGNWDNVDRVRKEMRQKGLMK 764 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E GCSW+ +AG+VNCF SRD KHPQ +IY+MLE+L + M DAGY+PC+ Q G + SE Sbjct: 765 EAGCSWVEVAGHVNCFMSRDHKHPQCAEIYQMLEKLAMEMKDAGYKPCLNLQTGGISASE 824 Query: 362 E 364 E Sbjct: 825 E 825 >ONI17874.1 hypothetical protein PRUPE_3G184500 [Prunus persica] Length = 822 Score = 168 bits (425), Expect = 7e-43 Identities = 78/121 (64%), Positives = 90/121 (74%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H F+LGKIVA K LE+E GN TGYHVLLSNI+AEEG WE+V+RVR+ M KGL K Sbjct: 702 CRIHKHFELGKIVAEKLLEIEAGNGKTGYHVLLSNIYAEEGKWENVDRVRKQMREKGLRK 761 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E GCSWI I G++NCF SRDQKHPQ D+IY MLEEL TM D GYRP + S + + E Sbjct: 762 ETGCSWIEITGFLNCFVSRDQKHPQCDEIYDMLEELTTTMKDTGYRPSLSSPLDAIMEPN 821 Query: 362 E 364 E Sbjct: 822 E 822 >XP_008229634.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Prunus mume] Length = 822 Score = 167 bits (422), Expect = 2e-42 Identities = 78/121 (64%), Positives = 90/121 (74%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H F+LGKIVA K LE+E GN TGYHVLLSNI+AEEG WE+V+RVR+ M KGL K Sbjct: 702 CRIHKHFELGKIVAEKLLEIEAGNGKTGYHVLLSNIYAEEGKWENVDRVRKQMREKGLRK 761 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E GCSWI I G++NCF SRDQKHPQ D+IY MLEEL +TM D GYRP S + + E Sbjct: 762 ETGCSWIEITGFLNCFVSRDQKHPQCDEIYDMLEELTMTMKDTGYRPSPSSPLDAMLEPN 821 Query: 362 E 364 E Sbjct: 822 E 822 >CAN74489.1 hypothetical protein VITISV_029273 [Vitis vinifera] Length = 102 Score = 147 bits (371), Expect = 1e-40 Identities = 65/102 (63%), Positives = 83/102 (81%) Frame = +2 Query: 59 MEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIKEVGCSWINIAGYVNCFASR 238 MEKG+S+TGYHVLLSNI+A EGNW++V+RVR+ M KGL+KE GCSW+ +AG+VNCF SR Sbjct: 1 MEKGSSLTGYHVLLSNIYAAEGNWDNVDRVRKEMRQKGLMKEAGCSWVEVAGHVNCFMSR 60 Query: 239 DQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESEE 364 D KHPQ +IY+MLE+L + M DAGY+PC+ Q G + SEE Sbjct: 61 DHKHPQCAEIYQMLEKLAMEMKDAGYKPCLNLQTGGISASEE 102 >XP_008365185.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Malus domestica] XP_008365186.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Malus domestica] Length = 822 Score = 159 bits (401), Expect = 1e-39 Identities = 71/118 (60%), Positives = 88/118 (74%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H F+LGKIVA K LE+E N TGYHVLLSN++AEEG WE+V+ VR+ M KGL K Sbjct: 702 CRIHKHFELGKIVAGKLLELEAANGKTGYHVLLSNMYAEEGKWENVDNVRKQMREKGLRK 761 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYE 355 E GCSWI+I+G++NCF SRDQ HPQ D+IY +LEEL + M D GYRP + S + + E Sbjct: 762 ETGCSWIDISGFLNCFTSRDQNHPQGDEIYDILEELTVKMKDTGYRPSLNSSLDAILE 819 >XP_009350666.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Pyrus x bretschneideri] XP_018501756.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Pyrus x bretschneideri] XP_018501757.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Pyrus x bretschneideri] XP_018501758.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Pyrus x bretschneideri] Length = 822 Score = 158 bits (400), Expect = 2e-39 Identities = 71/118 (60%), Positives = 88/118 (74%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H F+LGKIVA K LE+E N TGYHVLLSN++AEEG WE+V+ VR+ M KGL K Sbjct: 702 CRIHKHFELGKIVAGKLLELEAANGKTGYHVLLSNMYAEEGKWENVDNVRKQMREKGLRK 761 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYE 355 E GCSWI+ +G++NCFASRDQ HPQ D+IY +LEEL + M D GYRP + S + + E Sbjct: 762 ETGCSWIDTSGFLNCFASRDQNHPQGDEIYDILEELTVKMKDTGYRPSLNSSLDAILE 819 >XP_011654005.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Cucumis sativus] XP_011654006.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Cucumis sativus] KGN54994.1 hypothetical protein Csa_4G620570 [Cucumis sativus] Length = 817 Score = 154 bits (388), Expect = 7e-38 Identities = 76/121 (62%), Positives = 90/121 (74%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H +F+LGK+VA K LEMEK N TGYHVLLSNI+AEE NWE+V+ VR+ M +GL K Sbjct: 697 CRIHKQFELGKLVAKKLLEMEKINGKTGYHVLLSNIYAEERNWENVDIVRKQMRERGLKK 756 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E G SWI IAGY+N FAS+D+KHPQSD IY MLEEL + M AGYRP S +G E + Sbjct: 757 ETGSSWIEIAGYMNHFASKDRKHPQSDQIYSMLEELLMEMKHAGYRPLSTSYLGGFLEPD 816 Query: 362 E 364 E Sbjct: 817 E 817 >XP_006576131.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Glycine max] Length = 752 Score = 153 bits (386), Expect = 1e-37 Identities = 69/121 (57%), Positives = 89/121 (73%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 C+ HG F+LGK++A K L ME + GYHVLLSNI+AEEG WE+V+RVR M KGL K Sbjct: 632 CKNHGYFELGKVIAEKLLNMETEKRIAGYHVLLSNIYAEEGEWENVDRVRNQMKEKGLQK 691 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E+GCSW+ IAG VN F SRD+KHPQS +IY +L++L + M DAGY+PC S + + ES Sbjct: 692 EMGCSWVEIAGCVNFFVSRDEKHPQSGEIYYILDKLTMDMKDAGYKPCNNSNLNRILESS 751 Query: 362 E 364 + Sbjct: 752 D 752 >KHN29870.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 800 Score = 153 bits (386), Expect = 1e-37 Identities = 69/121 (57%), Positives = 89/121 (73%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 C+ HG F+LGK++A K L ME + GYHVLLSNI+AEEG WE+V+RVR M KGL K Sbjct: 680 CKNHGYFELGKVIAEKLLNMETEKRIAGYHVLLSNIYAEEGEWENVDRVRNQMKEKGLQK 739 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E+GCSW+ IAG VN F SRD+KHPQS +IY +L++L + M DAGY+PC S + + ES Sbjct: 740 EMGCSWVEIAGCVNFFVSRDEKHPQSGEIYYILDKLTMDMKDAGYKPCNNSNLNRILESS 799 Query: 362 E 364 + Sbjct: 800 D 800 >XP_007216509.1 hypothetical protein PRUPE_ppa025580mg, partial [Prunus persica] Length = 804 Score = 153 bits (386), Expect = 1e-37 Identities = 71/102 (69%), Positives = 80/102 (78%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H F+LGKIVA K LE+E GN TGYHVLLSNI+AEEG WE+V+RVR+ M KGL K Sbjct: 702 CRIHKHFELGKIVAEKLLEIEAGNGKTGYHVLLSNIYAEEGKWENVDRVRKQMREKGLRK 761 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMND 307 E GCSWI I G++NCF SRDQKHPQ D+IY MLEEL TM D Sbjct: 762 ETGCSWIEITGFLNCFVSRDQKHPQCDEIYDMLEELTTTMKD 803 >XP_015970900.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Arachis duranensis] Length = 848 Score = 152 bits (385), Expect = 2e-37 Identities = 67/121 (55%), Positives = 88/121 (72%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 C+ HG F+LGK+VA K L ME+ M GYHVLLSNI+AEEG W++V RVR M KGL K Sbjct: 723 CKNHGYFELGKVVAEKLLNMEREQRMAGYHVLLSNIYAEEGEWQNVYRVRNQMKEKGLQK 782 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E+GCSW+ ++G++NCF SRD+KHPQS +IYK+L++L M DAGY+P + + E Sbjct: 783 EIGCSWVEVSGFLNCFISRDEKHPQSAEIYKVLDQLTKDMKDAGYKPSFGPNLNMTLEPN 842 Query: 362 E 364 E Sbjct: 843 E 843 >XP_012568696.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Cicer arietinum] Length = 828 Score = 152 bits (384), Expect = 2e-37 Identities = 69/111 (62%), Positives = 83/111 (74%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 C+ HG F+LGK+VA K L M M GYHVLLSNI+AEEG WE+V+RVR+ M KGL K Sbjct: 711 CKNHGHFELGKVVAKKLLNMGTEKRMAGYHVLLSNIYAEEGEWENVDRVRKKMKEKGLQK 770 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVES 334 E GCSWI I G+VNCF SRD+KH QSD+IY ML++L + M DAGY+P S Sbjct: 771 ETGCSWIEIVGFVNCFVSRDEKHTQSDEIYNMLDKLTLDMKDAGYKPLYSS 821 >XP_008464638.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Cucumis melo] XP_008464639.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Cucumis melo] XP_008464640.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Cucumis melo] XP_016903224.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Cucumis melo] Length = 817 Score = 152 bits (383), Expect = 3e-37 Identities = 75/121 (61%), Positives = 90/121 (74%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H +F+LGK+VA K LEMEK N TGYHVLLSNI+AEE NWE+V+ VR+ M +GL K Sbjct: 697 CRIHKQFELGKLVAKKLLEMEKRNGKTGYHVLLSNIYAEERNWENVDIVRKQMRERGLKK 756 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E G SWI IAGY+N FAS+D++HPQSD IY MLEEL + M AGYRP S +G E + Sbjct: 757 ETGSSWIEIAGYMNHFASKDRRHPQSDQIYGMLEELLMEMKHAGYRPQSTSYLGGFLEPD 816 Query: 362 E 364 E Sbjct: 817 E 817 >XP_003618091.1 PPR containing plant-like protein [Medicago truncatula] AET01050.1 PPR containing plant-like protein [Medicago truncatula] Length = 828 Score = 151 bits (382), Expect = 4e-37 Identities = 70/121 (57%), Positives = 85/121 (70%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR HG F+LGK VA K L M M GYHVLLSNI+AEEG WE V+RVR+ M KGL K Sbjct: 708 CRNHGHFELGKAVAKKLLNMGMDKRMAGYHVLLSNIYAEEGEWEKVDRVRKQMKEKGLHK 767 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVESQIGLVYESE 361 E GCSW+ IAG+VNCF SRD+KHPQS +IY ML+ L + M AGY+P + + +S+ Sbjct: 768 ETGCSWVEIAGFVNCFVSRDEKHPQSSEIYYMLDMLTLDMKYAGYKPQYSLNLNTILDSD 827 Query: 362 E 364 E Sbjct: 828 E 828 >XP_019264789.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana attenuata] XP_019264790.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana attenuata] XP_019264791.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana attenuata] XP_019264792.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana attenuata] XP_019264793.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana attenuata] XP_019264794.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana attenuata] OIT36162.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 839 Score = 150 bits (379), Expect = 1e-36 Identities = 69/110 (62%), Positives = 84/110 (76%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H F+LGKIV++K LE+E + ++GYHVLLSNI+AEEGNW+SV+ VR GM GL K Sbjct: 719 CRVHRNFELGKIVSSKLLELEGSDRISGYHVLLSNIYAEEGNWQSVDNVRRGMRKMGLSK 778 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVE 331 EVGCSWI +GY +CF SRD+KHPQSD IY ML L I M D GY+P +E Sbjct: 779 EVGCSWIGTSGYPSCFVSRDRKHPQSDMIYDMLGHLTINMKDVGYKPNLE 828 >XP_018632863.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632864.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632865.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632866.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632867.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632868.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632869.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632870.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632871.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] XP_018632872.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Nicotiana tomentosiformis] Length = 839 Score = 150 bits (379), Expect = 1e-36 Identities = 69/110 (62%), Positives = 84/110 (76%) Frame = +2 Query: 2 CRTHGEFQLGKIVANKFLEMEKGNSMTGYHVLLSNIFAEEGNWESVNRVREGMHGKGLIK 181 CR H F+LGKIV++K LE+E + ++GYHVLLSNI+AEEGNW+SV+ VR GM GL K Sbjct: 719 CRVHRNFELGKIVSSKLLELEGSDRISGYHVLLSNIYAEEGNWQSVDNVRRGMRKMGLSK 778 Query: 182 EVGCSWINIAGYVNCFASRDQKHPQSDDIYKMLEELGITMNDAGYRPCVE 331 EVGCSWI +GY +CF SRD+KHPQSD IY ML L I M D GY+P +E Sbjct: 779 EVGCSWIGTSGYPSCFVSRDRKHPQSDMIYDMLGHLTINMKDVGYKPNLE 828