BLASTX nr result
ID: Panax24_contig00033948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00033948 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB67888.1 hypothetical protein B456_010G216600 [Gossypium raimo... 105 9e-24 EOY19811.1 DNA-directed RNA polymerase E subunit 1, putative iso... 105 9e-24 XP_017984847.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 XP_007010999.2 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 EOY19809.1 DNA-directed RNA polymerase E subunit 1, putative iso... 105 9e-24 XP_002265533.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 KJB67890.1 hypothetical protein B456_010G216600 [Gossypium raimo... 105 9e-24 KJB67889.1 hypothetical protein B456_010G216600 [Gossypium raimo... 105 9e-24 CBI40152.3 unnamed protein product, partial [Vitis vinifera] 105 9e-24 XP_011020393.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 XP_002303926.2 hypothetical protein POPTR_0003s19630g [Populus t... 105 9e-24 XP_012449584.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 OMP00131.1 RNA polymerase, alpha subunit [Corchorus capsularis] 105 9e-24 OMO87191.1 RNA polymerase, alpha subunit [Corchorus olitorius] 105 9e-24 XP_016714729.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 XP_016754189.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 XP_012449583.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 XP_017645439.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 KHG00588.1 DNA-directed RNA polymerase E subunit 1 -like protein... 105 9e-24 XP_011089162.1 PREDICTED: DNA-directed RNA polymerase V subunit ... 105 9e-24 >KJB67888.1 hypothetical protein B456_010G216600 [Gossypium raimondii] Length = 1406 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >EOY19811.1 DNA-directed RNA polymerase E subunit 1, putative isoform 3 [Theobroma cacao] Length = 1675 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 383 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 433 >XP_017984847.1 PREDICTED: DNA-directed RNA polymerase V subunit 1 isoform X2 [Theobroma cacao] Length = 1786 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 381 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 431 >XP_007010999.2 PREDICTED: DNA-directed RNA polymerase V subunit 1 isoform X1 [Theobroma cacao] Length = 1788 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 383 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 433 >EOY19809.1 DNA-directed RNA polymerase E subunit 1, putative isoform 1 [Theobroma cacao] EOY19810.1 DNA-directed RNA polymerase E subunit 1, putative isoform 1 [Theobroma cacao] Length = 1788 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 383 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 433 >XP_002265533.1 PREDICTED: DNA-directed RNA polymerase V subunit 1 [Vitis vinifera] Length = 1830 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >KJB67890.1 hypothetical protein B456_010G216600 [Gossypium raimondii] Length = 1841 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 373 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 423 >KJB67889.1 hypothetical protein B456_010G216600 [Gossypium raimondii] Length = 1883 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >CBI40152.3 unnamed protein product, partial [Vitis vinifera] Length = 1890 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 442 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 492 >XP_011020393.1 PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Populus euphratica] XP_011020394.1 PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Populus euphratica] XP_011020395.1 PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Populus euphratica] XP_011020396.1 PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Populus euphratica] Length = 1916 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 384 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 434 >XP_002303926.2 hypothetical protein POPTR_0003s19630g [Populus trichocarpa] EEE78905.2 hypothetical protein POPTR_0003s19630g [Populus trichocarpa] Length = 1920 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 388 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 438 >XP_012449584.1 PREDICTED: DNA-directed RNA polymerase V subunit 1 isoform X2 [Gossypium raimondii] Length = 1921 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >OMP00131.1 RNA polymerase, alpha subunit [Corchorus capsularis] Length = 1928 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 383 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 433 >OMO87191.1 RNA polymerase, alpha subunit [Corchorus olitorius] Length = 1956 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 383 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 433 >XP_016714729.1 PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Gossypium hirsutum] Length = 1957 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >XP_016754189.1 PREDICTED: DNA-directed RNA polymerase V subunit 1-like [Gossypium hirsutum] Length = 1963 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >XP_012449583.1 PREDICTED: DNA-directed RNA polymerase V subunit 1 isoform X1 [Gossypium raimondii] KJB67887.1 hypothetical protein B456_010G216600 [Gossypium raimondii] Length = 1966 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >XP_017645439.1 PREDICTED: DNA-directed RNA polymerase V subunit 1 [Gossypium arboreum] Length = 1969 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >KHG00588.1 DNA-directed RNA polymerase E subunit 1 -like protein [Gossypium arboreum] Length = 1996 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 382 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 432 >XP_011089162.1 PREDICTED: DNA-directed RNA polymerase V subunit 1 [Sesamum indicum] Length = 2096 Score = 105 bits (263), Expect = 9e-24 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +3 Query: 3 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKRSLQALSIYIHD 155 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHK SLQALS+Y+HD Sbjct: 372 YSLREGSKGHTFLRPGQVVHRRIMDGDIVFINRPPTTHKHSLQALSVYVHD 422