BLASTX nr result
ID: Panax24_contig00033937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00033937 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006378676.1 hypothetical protein POPTR_0010s199201g, partial ... 61 2e-09 XP_011035996.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A-... 63 8e-09 XP_013462763.1 NAD(P)-binding rossmann-fold protein [Medicago tr... 63 8e-09 XP_015888019.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A-... 61 4e-08 XP_015573500.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A ... 61 5e-08 EEF45349.1 short-chain dehydrogenase, putative [Ricinus communis] 61 6e-08 XP_003602761.2 3-ketodihydrosphingosine reductase-like protein [... 61 6e-08 CDO99009.1 unnamed protein product [Coffea canephora] 59 7e-08 XP_013442710.1 transmembrane protein, putative [Medicago truncat... 58 9e-08 KDO74751.1 hypothetical protein CISIN_1g0177572mg, partial [Citr... 57 1e-07 XP_003618406.2 transmembrane protein, putative [Medicago truncat... 58 2e-07 XP_004486137.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A ... 59 2e-07 GAV84595.1 adh_short domain-containing protein [Cephalotus folli... 59 2e-07 GAU33457.1 hypothetical protein TSUD_380930 [Trifolium subterran... 58 6e-07 KDP40124.1 hypothetical protein JCGZ_02122 [Jatropha curcas] 58 6e-07 XP_012069553.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A-... 58 6e-07 XP_012069554.1 PREDICTED: somatic embryogenesis receptor kinase ... 58 7e-07 KVH99922.1 Glucose/ribitol dehydrogenase [Cynara cardunculus var... 57 8e-07 XP_006489323.2 PREDICTED: 3-dehydrosphinganine reductase TSC10A-... 57 8e-07 XP_006419849.1 hypothetical protein CICLE_v10005413mg [Citrus cl... 57 8e-07 >XP_006378676.1 hypothetical protein POPTR_0010s199201g, partial [Populus trichocarpa] ERP56473.1 hypothetical protein POPTR_0010s199201g, partial [Populus trichocarpa] Length = 98 Score = 60.8 bits (146), Expect = 2e-09 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQK 384 AAGI+R+AALCFQWNWYGSIEKWH QK Sbjct: 69 AAGIVRIAALCFQWNWYGSIEKWHMQK 95 >XP_011035996.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Populus euphratica] Length = 340 Score = 63.2 bits (152), Expect = 8e-09 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR*FLVFWC 360 AAG+LR+AALCFQWNWYGSIEKWH +K WC Sbjct: 297 AAGLLRIAALCFQWNWYGSIEKWHMKKTELRSSWC 331 >XP_013462763.1 NAD(P)-binding rossmann-fold protein [Medicago truncatula] KEH36798.1 NAD(P)-binding rossmann-fold protein [Medicago truncatula] Length = 370 Score = 63.2 bits (152), Expect = 8e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR*FL 372 AAGI+R+AALCFQWNWYGSIEKWH Q++ FL Sbjct: 294 AAGIMRIAALCFQWNWYGSIEKWHKQRKLFL 324 >XP_015888019.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Ziziphus jujuba] XP_015888020.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A-like [Ziziphus jujuba] Length = 352 Score = 61.2 bits (147), Expect = 4e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 AAG+LRVAALCFQWNWYGSIEKWH+Q + Sbjct: 325 AAGLLRVAALCFQWNWYGSIEKWHSQNK 352 >XP_015573500.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A [Ricinus communis] Length = 349 Score = 60.8 bits (146), Expect = 5e-08 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 AAG++R+ ALCFQWNWYGSIEKWHAQK+ Sbjct: 322 AAGLIRLVALCFQWNWYGSIEKWHAQKK 349 >EEF45349.1 short-chain dehydrogenase, putative [Ricinus communis] Length = 456 Score = 60.8 bits (146), Expect = 6e-08 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 AAG++R+ ALCFQWNWYGSIEKWHAQK+ Sbjct: 299 AAGLIRLVALCFQWNWYGSIEKWHAQKK 326 >XP_003602761.2 3-ketodihydrosphingosine reductase-like protein [Medicago truncatula] AES73012.2 3-ketodihydrosphingosine reductase-like protein [Medicago truncatula] Length = 459 Score = 60.8 bits (146), Expect = 6e-08 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 AAGI+R+AALCFQWNWYGSIEKWH Q++ Sbjct: 402 AAGIMRIAALCFQWNWYGSIEKWHKQRK 429 >CDO99009.1 unnamed protein product [Coffea canephora] Length = 181 Score = 58.9 bits (141), Expect = 7e-08 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 AA ILR+AALCFQWNWY SIE+WHAQK+ Sbjct: 153 AASILRIAALCFQWNWYASIERWHAQKK 180 >XP_013442710.1 transmembrane protein, putative [Medicago truncatula] KEH16735.1 transmembrane protein, putative [Medicago truncatula] Length = 140 Score = 57.8 bits (138), Expect = 9e-08 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR*FLVFWCFTTGMQCS 336 AAGI+ +AALC QWNWYGSIEKWH Q++ W G C+ Sbjct: 52 AAGIMCIAALCLQWNWYGSIEKWHKQRKYCDYQWILKRGKFCT 94 >KDO74751.1 hypothetical protein CISIN_1g0177572mg, partial [Citrus sinensis] Length = 139 Score = 57.4 bits (137), Expect = 1e-07 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQ 387 AAG++R ALCFQWNWYGSIEKWHAQ Sbjct: 108 AAGLIRFVALCFQWNWYGSIEKWHAQ 133 >XP_003618406.2 transmembrane protein, putative [Medicago truncatula] AES74624.2 transmembrane protein, putative [Medicago truncatula] Length = 194 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR*FLVFWCFTTGMQCS 336 AAGI+ +AALC QWNWYGSIEKWH Q++ W G C+ Sbjct: 52 AAGIMCIAALCLQWNWYGSIEKWHKQRKYCDYQWILKRGKFCT 94 >XP_004486137.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A [Cicer arietinum] Length = 327 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -1 Query: 461 AGILRVAALCFQWNWYGSIEKWHAQKR 381 AGILR+AALCFQWNWYGSIEKWH +++ Sbjct: 295 AGILRIAALCFQWNWYGSIEKWHKERK 321 >GAV84595.1 adh_short domain-containing protein [Cephalotus follicularis] Length = 353 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQK 384 ++GI+R+A LCFQWNWYGSIEKWHAQK Sbjct: 323 SSGIVRIAGLCFQWNWYGSIEKWHAQK 349 >GAU33457.1 hypothetical protein TSUD_380930 [Trifolium subterraneum] Length = 322 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -1 Query: 461 AGILRVAALCFQWNWYGSIEKWHAQKR 381 AGILR AA+CFQWNWYGSIEKWH +K+ Sbjct: 289 AGILRFAAICFQWNWYGSIEKWHMEKK 315 >KDP40124.1 hypothetical protein JCGZ_02122 [Jatropha curcas] Length = 325 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 AA ++R+ ALCFQWNWYGSIEKWHAQK+ Sbjct: 296 AASMIRLLALCFQWNWYGSIEKWHAQKK 323 >XP_012069553.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A-like isoform X1 [Jatropha curcas] Length = 364 Score = 57.8 bits (138), Expect = 6e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 AA ++R+ ALCFQWNWYGSIEKWHAQK+ Sbjct: 335 AASMIRLLALCFQWNWYGSIEKWHAQKK 362 >XP_012069554.1 PREDICTED: somatic embryogenesis receptor kinase 1-like isoform X2 [Jatropha curcas] Length = 715 Score = 57.8 bits (138), Expect = 7e-07 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 AA ++R+ ALCFQWNWYGSIEKWHAQK+ Sbjct: 335 AASMIRLLALCFQWNWYGSIEKWHAQKK 362 >KVH99922.1 Glucose/ribitol dehydrogenase [Cynara cardunculus var. scolymus] Length = 324 Score = 57.4 bits (137), Expect = 8e-07 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQKR 381 +AG+LR+A LCFQW WYGSIEKWHAQ++ Sbjct: 297 SAGLLRIAGLCFQWTWYGSIEKWHAQQK 324 >XP_006489323.2 PREDICTED: 3-dehydrosphinganine reductase TSC10A-like isoform X2 [Citrus sinensis] Length = 325 Score = 57.4 bits (137), Expect = 8e-07 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQ 387 AAG++R ALCFQWNWYGSIEKWHAQ Sbjct: 296 AAGLIRFVALCFQWNWYGSIEKWHAQ 321 >XP_006419849.1 hypothetical protein CICLE_v10005413mg [Citrus clementina] XP_015389165.1 PREDICTED: 3-dehydrosphinganine reductase TSC10A-like isoform X1 [Citrus sinensis] ESR33089.1 hypothetical protein CICLE_v10005413mg [Citrus clementina] Length = 327 Score = 57.4 bits (137), Expect = 8e-07 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 464 AAGILRVAALCFQWNWYGSIEKWHAQ 387 AAG++R ALCFQWNWYGSIEKWHAQ Sbjct: 296 AAGLIRFVALCFQWNWYGSIEKWHAQ 321