BLASTX nr result
ID: Panax24_contig00033419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00033419 (482 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017252195.1 PREDICTED: pentatricopeptide repeat-containing pr... 167 9e-47 XP_017254378.1 PREDICTED: pentatricopeptide repeat-containing pr... 160 9e-44 XP_018850364.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 6e-37 XP_007211848.1 hypothetical protein PRUPE_ppa004720mg [Prunus pe... 138 9e-36 XP_008226646.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 1e-35 XP_002282230.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 1e-35 CBI20322.3 unnamed protein product, partial [Vitis vinifera] 138 6e-35 XP_016464319.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 7e-35 XP_009595568.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 7e-35 XP_006451898.1 hypothetical protein CICLE_v10007647mg [Citrus cl... 137 8e-35 XP_015388814.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 9e-35 KDO74080.1 hypothetical protein CISIN_1g011236mg [Citrus sinensis] 135 9e-35 XP_016581233.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 3e-34 XP_012084942.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 3e-34 XP_016435774.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 4e-34 XP_009789509.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 4e-34 XP_019249754.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 5e-34 XP_015954074.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 5e-34 XP_010062875.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 6e-34 XP_019413597.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 9e-34 >XP_017252195.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Daucus carota subsp. sativus] Length = 477 Score = 167 bits (423), Expect = 9e-47 Identities = 77/109 (70%), Positives = 94/109 (86%) Frame = -2 Query: 328 SGDLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFIRELRARKRYCHALQFSEWM 149 S LF+KIST RDP SI+PVLDQ+I+EG KV+ + QRF+RELR+RKRY HALQ SEW+ Sbjct: 10 SNGLFQKISTFRDPKASIVPVLDQYIREGNKVKAADLQRFVRELRSRKRYLHALQLSEWV 69 Query: 148 SSKNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEKDEKTYGAL 2 ++ N+C DSSGNHA+QLDLIG VRG+DAAE+YF+NLTD EKDE+TYGAL Sbjct: 70 NTNNYCRDSSGNHAVQLDLIGAVRGIDAAENYFSNLTDKEKDERTYGAL 118 >XP_017254378.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Daucus carota subsp. sativus] XP_017254379.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Daucus carota subsp. sativus] XP_017254380.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Daucus carota subsp. sativus] XP_017254381.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Daucus carota subsp. sativus] XP_017254382.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Daucus carota subsp. sativus] XP_017254383.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Daucus carota subsp. sativus] KZM91651.1 hypothetical protein DCAR_020984 [Daucus carota subsp. sativus] Length = 508 Score = 160 bits (404), Expect = 9e-44 Identities = 83/148 (56%), Positives = 105/148 (70%), Gaps = 5/148 (3%) Frame = -2 Query: 430 MGAKISAITSNSNPNNLMKDVIFFQAYR-----RAKK*NSGDLFKKISTLRDPNVSIIPV 266 MG IS I + N NNL+K R ++K NS LF++I+ LRDP VSI+PV Sbjct: 1 MGTTISTIKPSCNTNNLIKTKSLLSLSRYSTATQSKPSNSSRLFQRINPLRDPKVSILPV 60 Query: 265 LDQWIKEGKKVQDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIG 86 LDQWI EG K ++ +FQRF+RELRA KRY HALQ EW++ NF P SSG+ A+QLDLIG Sbjct: 61 LDQWITEGNKFKEPDFQRFVRELRASKRYSHALQLCEWVNINNFYPVSSGHLALQLDLIG 120 Query: 85 VVRGVDAAESYFNNLTDIEKDEKTYGAL 2 V RG+DAAE +F+ L++ EKDE+TYGAL Sbjct: 121 VARGLDAAECFFDKLSEKEKDERTYGAL 148 >XP_018850364.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Juglans regia] Length = 508 Score = 142 bits (357), Expect = 6e-37 Identities = 71/138 (51%), Positives = 99/138 (71%), Gaps = 2/138 (1%) Frame = -2 Query: 409 ITSNSNPNNLMKDVIFFQAYRRAKK*NSG--DLFKKISTLRDPNVSIIPVLDQWIKEGKK 236 +TS + NL ++ I K+ +SG +LF +IS L DP++S++PVLDQW++EG K Sbjct: 7 LTSLNRSMNLTENAILIIRSYSTKRHDSGRRNLFSRISPLGDPSLSVVPVLDQWVEEGNK 66 Query: 235 VQDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAES 56 V+ EFQR +R+LRAR+RY AL+ SEW+S C S G+ A+QLDLIG VRG+D+AES Sbjct: 67 VKALEFQRIVRDLRARRRYKQALEVSEWVSCTKLCSFSPGDQAVQLDLIGRVRGLDSAES 126 Query: 55 YFNNLTDIEKDEKTYGAL 2 YFNNL+D +K +K YG+L Sbjct: 127 YFNNLSDQDKIDKIYGSL 144 >XP_007211848.1 hypothetical protein PRUPE_ppa004720mg [Prunus persica] ONI12784.1 hypothetical protein PRUPE_4G183500 [Prunus persica] ONI12785.1 hypothetical protein PRUPE_4G183500 [Prunus persica] Length = 494 Score = 138 bits (348), Expect = 9e-36 Identities = 68/110 (61%), Positives = 86/110 (78%) Frame = -2 Query: 331 NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFIRELRARKRYCHALQFSEW 152 N+ +LF +IS L DP++S++PVLDQW++EG KV FE QR +R+LRARKRY HAL SEW Sbjct: 33 NTRNLFSRISPLGDPSLSVVPVLDQWVQEGGKVNYFELQRIVRDLRARKRYRHALDVSEW 92 Query: 151 MSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEKDEKTYGAL 2 MSSK C G+HA+QLDLIG VRG+DAAES F++L+D E K+YGAL Sbjct: 93 MSSKGLCQFLPGDHAVQLDLIGRVRGLDAAESCFSSLSD-EDTSKSYGAL 141 >XP_008226646.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Prunus mume] Length = 494 Score = 138 bits (347), Expect = 1e-35 Identities = 74/129 (57%), Positives = 94/129 (72%), Gaps = 1/129 (0%) Frame = -2 Query: 385 NLMKDVIFFQAYRRAKK*-NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRF 209 NL +V + Y RA+ N+ +LF +IS L DP +S++PVLDQW++EG KV FE QR Sbjct: 14 NLAANVSPVKFYCRARHTANTRNLFSRISPLGDPFLSVVPVLDQWVQEGGKVNYFELQRI 73 Query: 208 IRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIE 29 +R+LRARKRY HAL SEWMSSK C G+HA+QLDLIG VRG+DAAES F++L+D E Sbjct: 74 VRDLRARKRYRHALDVSEWMSSKGLCQFLPGDHAVQLDLIGRVRGLDAAESCFSSLSD-E 132 Query: 28 KDEKTYGAL 2 K+YGAL Sbjct: 133 DTSKSYGAL 141 >XP_002282230.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial [Vitis vinifera] Length = 504 Score = 138 bits (347), Expect = 1e-35 Identities = 64/107 (59%), Positives = 84/107 (78%) Frame = -2 Query: 322 DLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFIRELRARKRYCHALQFSEWMSS 143 +L+ +IS L PN+S++PVLDQW++EGKKV+D E R IR+LR+RKRY AL+ SEWMSS Sbjct: 38 NLYSRISPLGTPNLSLVPVLDQWVEEGKKVRDVELHRIIRDLRSRKRYAQALEVSEWMSS 97 Query: 142 KNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEKDEKTYGAL 2 K CP S A+QLDLIG VRG+++AE+YFNN++ EK +K YGAL Sbjct: 98 KELCPFSPSARAVQLDLIGQVRGLESAENYFNNMSAEEKIDKMYGAL 144 >CBI20322.3 unnamed protein product, partial [Vitis vinifera] Length = 687 Score = 138 bits (347), Expect = 6e-35 Identities = 64/107 (59%), Positives = 84/107 (78%) Frame = -2 Query: 322 DLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFIRELRARKRYCHALQFSEWMSS 143 +L+ +IS L PN+S++PVLDQW++EGKKV+D E R IR+LR+RKRY AL+ SEWMSS Sbjct: 38 NLYSRISPLGTPNLSLVPVLDQWVEEGKKVRDVELHRIIRDLRSRKRYAQALEVSEWMSS 97 Query: 142 KNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEKDEKTYGAL 2 K CP S A+QLDLIG VRG+++AE+YFNN++ EK +K YGAL Sbjct: 98 KELCPFSPSARAVQLDLIGQVRGLESAENYFNNMSAEEKIDKMYGAL 144 >XP_016464319.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Nicotiana tabacum] Length = 502 Score = 136 bits (342), Expect = 7e-35 Identities = 71/137 (51%), Positives = 92/137 (67%) Frame = -2 Query: 412 AITSNSNPNNLMKDVIFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKV 233 A + S NL++ F+AY +LF +IS +R ++ IIPVLDQW+ EG+KV Sbjct: 24 ATLNRSISYNLLRRAFPFRAYCTVYSSKRNNLFSRISPVRRADL-IIPVLDQWVVEGRKV 82 Query: 232 QDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESY 53 E QR +R+LR+RKR+ ALQ SEWMS CP SG+ A+ LDLIGVV G +AAE Y Sbjct: 83 TSLELQRIVRDLRSRKRFSQALQVSEWMSVSGLCPFKSGDCAVHLDLIGVVHGWEAAECY 142 Query: 52 FNNLTDIEKDEKTYGAL 2 FNNLTD +K++KTYGAL Sbjct: 143 FNNLTDEQKNDKTYGAL 159 >XP_009595568.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Nicotiana tomentosiformis] Length = 502 Score = 136 bits (342), Expect = 7e-35 Identities = 71/137 (51%), Positives = 92/137 (67%) Frame = -2 Query: 412 AITSNSNPNNLMKDVIFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKV 233 A + S NL++ F+AY +LF +IS +R ++ IIPVLDQW+ EG+KV Sbjct: 24 ATLNRSISYNLLRRAFPFRAYCTVYSSKRNNLFSRISPVRRADL-IIPVLDQWVVEGRKV 82 Query: 232 QDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESY 53 E QR +R+LR+RKR+ ALQ SEWMS CP SG+ A+ LDLIGVV G +AAE Y Sbjct: 83 TSLELQRIVRDLRSRKRFSQALQVSEWMSVSGLCPFKSGDCAVHLDLIGVVHGWEAAECY 142 Query: 52 FNNLTDIEKDEKTYGAL 2 FNNLTD +K++KTYGAL Sbjct: 143 FNNLTDEQKNDKTYGAL 159 >XP_006451898.1 hypothetical protein CICLE_v10007647mg [Citrus clementina] ESR65138.1 hypothetical protein CICLE_v10007647mg [Citrus clementina] Length = 681 Score = 137 bits (346), Expect = 8e-35 Identities = 72/144 (50%), Positives = 101/144 (70%), Gaps = 1/144 (0%) Frame = -2 Query: 430 MGAKISAITSNSNPNNLMKDV-IFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQW 254 M +K+ + N+ N ++ IF +AYR AK +L+ +IS L DP+VS+ PVLDQW Sbjct: 1 MASKLFSTIFNNKRNFTKTNLEIFTRAYRAAKPVARNNLYSRISPLGDPDVSLTPVLDQW 60 Query: 253 IKEGKKVQDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRG 74 + EG+K+ + E QR IR+LR+RKR+ HALQ SEWMS + S +HA+QLDLIG VRG Sbjct: 61 VLEGQKISELELQRIIRQLRSRKRFKHALQVSEWMSGQGLA-FSVRDHAVQLDLIGKVRG 119 Query: 73 VDAAESYFNNLTDIEKDEKTYGAL 2 +++AE+YFN+L D +K +K YGAL Sbjct: 120 LESAETYFNSLNDEDKVDKLYGAL 143 >XP_015388814.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Citrus sinensis] Length = 490 Score = 135 bits (341), Expect = 9e-35 Identities = 71/144 (49%), Positives = 100/144 (69%), Gaps = 1/144 (0%) Frame = -2 Query: 430 MGAKISAITSNSNPNNLMKDV-IFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQW 254 M +K+ + N+ N ++ IF +AYR K +L+ +IS L DP+VS+ PVLDQW Sbjct: 1 MASKLFSTIFNNKRNFTKTNLEIFTRAYRAVKPVARNNLYSRISPLGDPDVSLTPVLDQW 60 Query: 253 IKEGKKVQDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRG 74 + EG+K+ + E QR IR+LR+RKR+ HALQ SEWMS + S +HA+QLDLIG VRG Sbjct: 61 VLEGQKISELELQRVIRQLRSRKRFKHALQVSEWMSGQGLA-FSVHDHAVQLDLIGKVRG 119 Query: 73 VDAAESYFNNLTDIEKDEKTYGAL 2 +++AE+YFN+L D +K +K YGAL Sbjct: 120 LESAETYFNSLNDEDKVDKLYGAL 143 >KDO74080.1 hypothetical protein CISIN_1g011236mg [Citrus sinensis] Length = 490 Score = 135 bits (341), Expect = 9e-35 Identities = 71/144 (49%), Positives = 100/144 (69%), Gaps = 1/144 (0%) Frame = -2 Query: 430 MGAKISAITSNSNPNNLMKDV-IFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQW 254 M +K+ + N+ N ++ IF +AYR K +L+ +IS L DP+VS+ PVLDQW Sbjct: 1 MASKLFSTIFNNKRNFTKTNLEIFTRAYRAVKPVARNNLYSRISPLGDPDVSLTPVLDQW 60 Query: 253 IKEGKKVQDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRG 74 + EG+K+ + E QR IR+LR+RKR+ HALQ SEWMS + S +HA+QLDLIG VRG Sbjct: 61 VLEGQKISELELQRVIRQLRSRKRFKHALQVSEWMSGQGLA-FSVHDHAVQLDLIGKVRG 119 Query: 73 VDAAESYFNNLTDIEKDEKTYGAL 2 +++AE+YFN+L D +K +K YGAL Sbjct: 120 LESAETYFNSLNDEDKVDKLYGAL 143 >XP_016581233.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Capsicum annuum] Length = 504 Score = 134 bits (338), Expect = 3e-34 Identities = 74/165 (44%), Positives = 102/165 (61%), Gaps = 7/165 (4%) Frame = -2 Query: 475 LYSFISKQHCPKFSVMGAKISAITSNSNPNNLMKDVIFFQAYRRA-------KK*NSGDL 317 + S ++ HC S+ I S+ N L K +I + +R +L Sbjct: 1 MLSTLNNCHC---SITPQSSKPINSSMNFAILNKSIISYNFLQRVFAIRVYCSNSKRNNL 57 Query: 316 FKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFIRELRARKRYCHALQFSEWMSSKN 137 F +IS +R ++ ++PVLDQW+ EG+KV FE QR IR+LR+RKR+ ALQ SEWMS + Sbjct: 58 FSRISPVRKADL-VVPVLDQWVDEGRKVNSFELQRIIRDLRSRKRFTQALQVSEWMSVRG 116 Query: 136 FCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEKDEKTYGAL 2 CP SG+ A+ LDLIGVV G +AAE YFNNLTD +K++KT+GAL Sbjct: 117 LCPFKSGDCAVHLDLIGVVHGWEAAECYFNNLTDEQKNDKTFGAL 161 >XP_012084942.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Jatropha curcas] KDP27040.1 hypothetical protein JCGZ_20975 [Jatropha curcas] Length = 506 Score = 134 bits (338), Expect = 3e-34 Identities = 67/128 (52%), Positives = 86/128 (67%) Frame = -2 Query: 385 NLMKDVIFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFI 206 +L D I + Y K DL +IS L DP +S+ PVLD+W++EG K ++F QR I Sbjct: 15 SLTADAILTRTYHSKSKTVKSDLLSRISPLGDPKISLTPVLDKWVEEGNKAKNFNLQRAI 74 Query: 205 RELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEK 26 R LRARKRY AL+ +EWMS K S +HA+QLDLIG VRG+++AESYF NL D +K Sbjct: 75 RSLRARKRYGQALEVAEWMSGKGINTLSPSDHAVQLDLIGRVRGLESAESYFRNLDDKDK 134 Query: 25 DEKTYGAL 2 +KTYGAL Sbjct: 135 VDKTYGAL 142 >XP_016435774.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Nicotiana tabacum] Length = 498 Score = 134 bits (337), Expect = 4e-34 Identities = 68/128 (53%), Positives = 88/128 (68%) Frame = -2 Query: 385 NLMKDVIFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFI 206 NL++ +AY +LF +IS +R ++ IIPVLDQW+ EG+KV E QR + Sbjct: 33 NLLRRAFPIRAYCTVHSSKGNNLFSRISPVRRADL-IIPVLDQWVVEGRKVTSLELQRIV 91 Query: 205 RELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEK 26 R+LR+RKR+ ALQ SEWMS CP SG+ A+ LDLIGVV G +AAE YFNNLTD +K Sbjct: 92 RDLRSRKRFSQALQVSEWMSVSGLCPFKSGDCAVHLDLIGVVHGWEAAECYFNNLTDEQK 151 Query: 25 DEKTYGAL 2 ++KTYGAL Sbjct: 152 NDKTYGAL 159 >XP_009789509.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Nicotiana sylvestris] Length = 498 Score = 134 bits (337), Expect = 4e-34 Identities = 68/128 (53%), Positives = 88/128 (68%) Frame = -2 Query: 385 NLMKDVIFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFI 206 NL++ +AY +LF +IS +R ++ IIPVLDQW+ EG+KV E QR + Sbjct: 33 NLLRRAFPIRAYCTVHSSKGNNLFSRISPVRRADL-IIPVLDQWVVEGRKVTSLELQRIV 91 Query: 205 RELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEK 26 R+LR+RKR+ ALQ SEWMS CP SG+ A+ LDLIGVV G +AAE YFNNLTD +K Sbjct: 92 RDLRSRKRFSQALQVSEWMSVSGLCPFKSGDCAVHLDLIGVVHGWEAAECYFNNLTDEQK 151 Query: 25 DEKTYGAL 2 ++KTYGAL Sbjct: 152 NDKTYGAL 159 >XP_019249754.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Nicotiana attenuata] OIT00428.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 498 Score = 134 bits (336), Expect = 5e-34 Identities = 70/137 (51%), Positives = 91/137 (66%) Frame = -2 Query: 412 AITSNSNPNNLMKDVIFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKV 233 A + S NL++ +AY +LF +IS +R ++ IIPVLDQW+ EG+KV Sbjct: 24 ATLNRSISYNLLRRAFPIRAYCTVYSSKRNNLFSRISPVRRADL-IIPVLDQWVVEGRKV 82 Query: 232 QDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESY 53 E QR +R+LR+RKR+ ALQ SEWMS CP SG+ A+ LDLIGVV G +AAE Y Sbjct: 83 TSLELQRIVRDLRSRKRFSQALQVSEWMSVSGLCPFKSGDCAVHLDLIGVVHGWEAAECY 142 Query: 52 FNNLTDIEKDEKTYGAL 2 FNNLTD +K++KTYGAL Sbjct: 143 FNNLTDEQKNDKTYGAL 159 >XP_015954074.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Arachis duranensis] XP_015954075.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Arachis duranensis] Length = 499 Score = 134 bits (336), Expect = 5e-34 Identities = 66/133 (49%), Positives = 92/133 (69%) Frame = -2 Query: 400 NSNPNNLMKDVIFFQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFE 221 NS L + I+F + + K N +L+ +IS L DP+VS++P+LD W+ EG V+ E Sbjct: 11 NSTSTFLQRSRIWFSSKNQVKTTNRKNLYSRISPLGDPSVSVVPILDHWLLEGHAVKAPE 70 Query: 220 FQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNL 41 +++LR+ KR+ AL+ SEWMSSK CP S+G+ AIQL+LIG VRG+D AESYF+NL Sbjct: 71 LHNIVKDLRSHKRFNQALEVSEWMSSKALCPISAGDQAIQLELIGRVRGLDYAESYFHNL 130 Query: 40 TDIEKDEKTYGAL 2 +D EK EK +GAL Sbjct: 131 SDQEKTEKLHGAL 143 >XP_010062875.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial [Eucalyptus grandis] KCW70018.1 hypothetical protein EUGRSUZ_F03326 [Eucalyptus grandis] Length = 480 Score = 133 bits (335), Expect = 6e-34 Identities = 68/138 (49%), Positives = 96/138 (69%), Gaps = 2/138 (1%) Frame = -2 Query: 409 ITSNSNPNNLMKDVIF--FQAYRRAKK*NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKK 236 + S NP+ ++ + + AY R K DLF +IS + DP S++PVLD+W++EG K Sbjct: 10 LKSCRNPSRIINAFLMRPYSAYLRYVK---KDLFSRISPIGDPKKSVVPVLDKWVEEGNK 66 Query: 235 VQDFEFQRFIRELRARKRYCHALQFSEWMSSKNFCPDSSGNHAIQLDLIGVVRGVDAAES 56 V+ + +R IR+LR+R+RY HALQ +EWMSSK + +HA++LDLIG V+G+D AE+ Sbjct: 67 VKGLDLKRIIRDLRSRRRYTHALQVAEWMSSKTEGLLTPADHALKLDLIGKVQGLDVAEN 126 Query: 55 YFNNLTDIEKDEKTYGAL 2 YFNNL D +K EKTYGAL Sbjct: 127 YFNNLRDQDKVEKTYGAL 144 >XP_019413597.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Lupinus angustifolius] OIV99155.1 hypothetical protein TanjilG_01130 [Lupinus angustifolius] Length = 493 Score = 133 bits (334), Expect = 9e-34 Identities = 60/110 (54%), Positives = 84/110 (76%) Frame = -2 Query: 331 NSGDLFKKISTLRDPNVSIIPVLDQWIKEGKKVQDFEFQRFIRELRARKRYCHALQFSEW 152 N +L+ +IS L DP++S++PVLD W+++G V F+ QR I+ LR+R+R+ ALQ SEW Sbjct: 27 NRKNLYSRISPLGDPSISLVPVLDNWVQQGNTVYPFDLQRIIKTLRSRRRFSQALQVSEW 86 Query: 151 MSSKNFCPDSSGNHAIQLDLIGVVRGVDAAESYFNNLTDIEKDEKTYGAL 2 MSSK CP S+G+ A+QLDLIG VRG+D AESYF NL++ +K +K +GAL Sbjct: 87 MSSKGLCPISAGDRAVQLDLIGKVRGLDIAESYFQNLSENDKTDKLHGAL 136