BLASTX nr result
ID: Panax24_contig00033329
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00033329 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012850166.1 PREDICTED: peroxidase 60 [Erythranthe guttata] 57 8e-07 EYU26722.1 hypothetical protein MIMGU_mgv1a024318mg [Erythranthe... 57 8e-07 XP_006424211.1 hypothetical protein CICLE_v10030190mg [Citrus cl... 55 5e-06 XP_006487931.2 PREDICTED: peroxidase 60 [Citrus sinensis] 54 7e-06 XP_011089203.1 PREDICTED: peroxidase 60 [Sesamum indicum] 54 7e-06 >XP_012850166.1 PREDICTED: peroxidase 60 [Erythranthe guttata] Length = 313 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 427 GLDFSTRLGQTMVKMGEIQVLTGRHGEIRKSCRVRNQ 317 G DFST+ GQ MVK+G IQVLTG+ GEIR+SCR N+ Sbjct: 276 GFDFSTKFGQAMVKLGSIQVLTGKQGEIRRSCRAINK 312 >EYU26722.1 hypothetical protein MIMGU_mgv1a024318mg [Erythranthe guttata] Length = 333 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 427 GLDFSTRLGQTMVKMGEIQVLTGRHGEIRKSCRVRNQ 317 G DFST+ GQ MVK+G IQVLTG+ GEIR+SCR N+ Sbjct: 296 GFDFSTKFGQAMVKLGSIQVLTGKQGEIRRSCRAINK 332 >XP_006424211.1 hypothetical protein CICLE_v10030190mg [Citrus clementina] ESR37451.1 hypothetical protein CICLE_v10030190mg [Citrus clementina] Length = 327 Score = 54.7 bits (130), Expect = 5e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 430 TGLDFSTRLGQTMVKMGEIQVLTGRHGEIRKSCRVRNQ 317 TG DF+ + G+ MVKMG +QVLTG GEIRKSCR N+ Sbjct: 289 TGNDFNAKFGEAMVKMGRVQVLTGNQGEIRKSCRAVNK 326 >XP_006487931.2 PREDICTED: peroxidase 60 [Citrus sinensis] Length = 325 Score = 54.3 bits (129), Expect = 7e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 430 TGLDFSTRLGQTMVKMGEIQVLTGRHGEIRKSCRVRNQ 317 TG DF+ + G+ MVKMG +QVLTG GEIRKSCR N+ Sbjct: 287 TGDDFNAKFGEAMVKMGRVQVLTGNQGEIRKSCRAVNK 324 >XP_011089203.1 PREDICTED: peroxidase 60 [Sesamum indicum] Length = 333 Score = 54.3 bits (129), Expect = 7e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -2 Query: 427 GLDFSTRLGQTMVKMGEIQVLTGRHGEIRKSCRVRNQ 317 G DFST+ GQ M+K+G +QVLTG GEIR SCR N+ Sbjct: 294 GFDFSTKFGQAMIKLGAVQVLTGEQGEIRGSCRATNK 330