BLASTX nr result
ID: Panax24_contig00033122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00033122 (446 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002279589.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 1e-17 EOX97443.1 Pentatricopeptide repeat (PPR) superfamily protein is... 79 2e-14 XP_007041611.2 PREDICTED: pentatricopeptide repeat-containing pr... 79 2e-14 EOX97442.1 Pentatricopeptide repeat (PPR) superfamily protein is... 79 2e-14 KHG06442.1 hypothetical protein F383_04652 [Gossypium arboreum] 79 4e-14 XP_017615908.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 4e-14 XP_016708550.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 4e-14 XP_012458104.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 4e-14 XP_006296960.1 hypothetical protein CARUB_v10012952mg, partial [... 78 5e-14 XP_017247804.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 1e-13 XP_003530995.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 1e-13 KZM96979.1 hypothetical protein DCAR_015659 [Daucus carota subsp... 77 1e-13 KDP42034.1 hypothetical protein JCGZ_03097 [Jatropha curcas] 77 2e-13 XP_019445608.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 2e-13 XP_012067167.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 2e-13 XP_002884041.1 binding protein [Arabidopsis lyrata subsp. lyrata... 76 3e-13 KYP51266.1 Pentatricopeptide repeat-containing protein At2g17140... 75 4e-13 XP_007200313.1 hypothetical protein PRUPE_ppa001249mg [Prunus pe... 75 4e-13 XP_008235960.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 4e-13 XP_010489330.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 4e-13 >XP_002279589.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] XP_010645876.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] CBI37747.3 unnamed protein product, partial [Vitis vinifera] Length = 878 Score = 88.6 bits (218), Expect = 1e-17 Identities = 40/57 (70%), Positives = 49/57 (85%) Frame = -1 Query: 434 KQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWDTTD 264 K+ K SGS+ QTI+HRDDGS +AL+ LK+VQKGWGQGSISSLQPQ+NDF D W+ T+ Sbjct: 822 KRNKFSGSDWQTIIHRDDGSGLALKALKRVQKGWGQGSISSLQPQKNDFLDYWEGTN 878 >EOX97443.1 Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] Length = 632 Score = 79.3 bits (194), Expect = 2e-14 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 H K+ K G + QTIVHRDDGS +AL+ LK+VQKGWGQGSIS LQP +N F D W+ Sbjct: 574 HRKEIKFGGDDWQTIVHRDDGSGIALKALKRVQKGWGQGSISRLQPHKNKFHDYWE 629 >XP_007041611.2 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Theobroma cacao] Length = 872 Score = 79.3 bits (194), Expect = 2e-14 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 H K+ K G + QTIVHRDDGS +AL+ LK+VQKGWGQGSIS LQP +N F D W+ Sbjct: 814 HRKEIKFGGDDWQTIVHRDDGSGIALKALKRVQKGWGQGSISRLQPHKNKFHDYWE 869 >EOX97442.1 Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 872 Score = 79.3 bits (194), Expect = 2e-14 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 H K+ K G + QTIVHRDDGS +AL+ LK+VQKGWGQGSIS LQP +N F D W+ Sbjct: 814 HRKEIKFGGDDWQTIVHRDDGSGIALKALKRVQKGWGQGSISRLQPHKNKFHDYWE 869 >KHG06442.1 hypothetical protein F383_04652 [Gossypium arboreum] Length = 748 Score = 78.6 bits (192), Expect = 4e-14 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSW 276 H K+ K+ G + QTIVHRDDGS +AL+TLK+VQKGWGQGSI SLQ ++ +F D W Sbjct: 694 HRKETKYGGDDWQTIVHRDDGSGIALKTLKRVQKGWGQGSIPSLQTEKTEFLDYW 748 >XP_017615908.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Gossypium arboreum] XP_017615909.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Gossypium arboreum] XP_017615911.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Gossypium arboreum] Length = 868 Score = 78.6 bits (192), Expect = 4e-14 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSW 276 H K+ K+ G + QTIVHRDDGS +AL+TLK+VQKGWGQGSI SLQ ++ +F D W Sbjct: 814 HRKETKYGGDDWQTIVHRDDGSGIALKTLKRVQKGWGQGSIPSLQTEKTEFLDYW 868 >XP_016708550.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Gossypium hirsutum] XP_016708551.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Gossypium hirsutum] Length = 868 Score = 78.6 bits (192), Expect = 4e-14 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSW 276 H K+ K+ G + QTIVHRDDGS +AL+TLK+VQKGWGQGSI SLQ ++ +F D W Sbjct: 814 HRKETKYGGDDWQTIVHRDDGSGIALKTLKRVQKGWGQGSIPSLQTEKTEFLDYW 868 >XP_012458104.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Gossypium raimondii] XP_012458105.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Gossypium raimondii] KJB77821.1 hypothetical protein B456_012G159300 [Gossypium raimondii] KJB77822.1 hypothetical protein B456_012G159300 [Gossypium raimondii] KJB77823.1 hypothetical protein B456_012G159300 [Gossypium raimondii] Length = 868 Score = 78.6 bits (192), Expect = 4e-14 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSW 276 H K+ K+ G + QTIVHRDDGS +AL+TLK+VQKGWGQGSI SLQ ++ +F D W Sbjct: 814 HRKETKYGGDDWQTIVHRDDGSGIALKTLKRVQKGWGQGSIPSLQTEKTEFLDYW 868 >XP_006296960.1 hypothetical protein CARUB_v10012952mg, partial [Capsella rubella] EOA29858.1 hypothetical protein CARUB_v10012952mg, partial [Capsella rubella] Length = 881 Score = 78.2 bits (191), Expect = 5e-14 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = -1 Query: 434 KQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 K +H G+N Q I+HRDDGS +AL+TL +V+KGWGQG ISS QPQR+D+ D W+ Sbjct: 825 KHTRHGGNNWQNILHRDDGSGIALKTLSRVKKGWGQGDISSFQPQRDDYLDYWE 878 >XP_017247804.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Daucus carota subsp. sativus] Length = 875 Score = 77.0 bits (188), Expect = 1e-13 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = -1 Query: 446 RSHGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 R + K KK+ S+ +TIVHRDDGS L+TL++VQKGWGQGSISS QP + D+ D WD Sbjct: 817 RVYEKSKKYRESDWKTIVHRDDGSGTTLKTLRRVQKGWGQGSISSFQPPKTDYLDVWD 874 >XP_003530995.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Glycine max] KRH41958.1 hypothetical protein GLYMA_08G060600 [Glycine max] KRH41959.1 hypothetical protein GLYMA_08G060600 [Glycine max] Length = 875 Score = 77.0 bits (188), Expect = 1e-13 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -1 Query: 437 GKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 GK K GS+ Q I++RD GS +AL+TLK+VQKGWGQGSISSLQPQ+NDF D +D Sbjct: 818 GKLLKDGGSDWQDIINRDAGSGIALKTLKRVQKGWGQGSISSLQPQQNDFLDYYD 872 >KZM96979.1 hypothetical protein DCAR_015659 [Daucus carota subsp. sativus] Length = 1303 Score = 77.0 bits (188), Expect = 1e-13 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = -1 Query: 446 RSHGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 R + K KK+ S+ +TIVHRDDGS L+TL++VQKGWGQGSISS QP + D+ D WD Sbjct: 1245 RVYEKSKKYRESDWKTIVHRDDGSGTTLKTLRRVQKGWGQGSISSFQPPKTDYLDVWD 1302 >KDP42034.1 hypothetical protein JCGZ_03097 [Jatropha curcas] Length = 736 Score = 76.6 bits (187), Expect = 2e-13 Identities = 35/56 (62%), Positives = 44/56 (78%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 H + K S+ Q IVHRDDGS +AL+ LK+VQKGWGQGSIS+LQPQ+++F D WD Sbjct: 678 HRNKIKDGESDWQAIVHRDDGSGIALKALKRVQKGWGQGSISTLQPQKDEFFDYWD 733 >XP_019445608.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Lupinus angustifolius] OIW10499.1 hypothetical protein TanjilG_00437 [Lupinus angustifolius] Length = 862 Score = 76.6 bits (187), Expect = 2e-13 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = -1 Query: 434 KQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 K +K GSN Q IVHRD+GS +AL+TLK+V KGWGQGSI+SL PQ+NDF D +D Sbjct: 803 KLRKTGGSNWQDIVHRDNGSGIALKTLKRVHKGWGQGSITSLPPQQNDFLDYYD 856 >XP_012067167.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Jatropha curcas] Length = 873 Score = 76.6 bits (187), Expect = 2e-13 Identities = 35/56 (62%), Positives = 44/56 (78%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 H + K S+ Q IVHRDDGS +AL+ LK+VQKGWGQGSIS+LQPQ+++F D WD Sbjct: 815 HRNKIKDGESDWQAIVHRDDGSGIALKALKRVQKGWGQGSISTLQPQKDEFFDYWD 870 >XP_002884041.1 binding protein [Arabidopsis lyrata subsp. lyrata] EFH60300.1 binding protein [Arabidopsis lyrata subsp. lyrata] Length = 874 Score = 75.9 bits (185), Expect = 3e-13 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = -1 Query: 434 KQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 K K+SG+N Q I+HRDDGS +AL++L +V+KGWGQG ISS QPQR D+ D W+ Sbjct: 818 KHNKYSGNNWQNILHRDDGSGIALKSLSRVKKGWGQGDISSFQPQRVDYLDYWE 871 >KYP51266.1 Pentatricopeptide repeat-containing protein At2g17140 family [Cajanus cajan] Length = 723 Score = 75.5 bits (184), Expect = 4e-13 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = -1 Query: 440 HGKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 HGK K GS+ Q IV+RD GS +AL+TLK+VQKGWGQGSI+SLQ Q+NDF D ++ Sbjct: 668 HGKLHKDGGSDWQDIVNRDGGSGIALKTLKRVQKGWGQGSITSLQSQQNDFLDYYE 723 >XP_007200313.1 hypothetical protein PRUPE_ppa001249mg [Prunus persica] ONH92488.1 hypothetical protein PRUPE_8G178500 [Prunus persica] Length = 872 Score = 75.5 bits (184), Expect = 4e-13 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = -1 Query: 437 GKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSD 282 GK + GS+ QTIVHRDDGS +AL+TLK+VQKGWG+GS++SLQ Q+N+F D Sbjct: 820 GKPSNNGGSDWQTIVHRDDGSGIALKTLKRVQKGWGRGSLTSLQSQKNEFID 871 >XP_008235960.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Prunus mume] Length = 873 Score = 75.5 bits (184), Expect = 4e-13 Identities = 34/52 (65%), Positives = 44/52 (84%) Frame = -1 Query: 437 GKQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSD 282 GK + GS+ QTIVHRDDGS +AL+TLK+VQKGWG+GS++SLQ Q+N+F D Sbjct: 821 GKPSNNGGSDWQTIVHRDDGSGIALKTLKRVQKGWGRGSLTSLQSQKNEFID 872 >XP_010489330.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Camelina sativa] XP_010489331.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Camelina sativa] XP_010489332.1 PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Camelina sativa] Length = 879 Score = 75.5 bits (184), Expect = 4e-13 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = -1 Query: 434 KQKKHSGSNRQTIVHRDDGSRMALRTLKQVQKGWGQGSISSLQPQRNDFSDSWD 273 K +H G+N Q I+HRDDGS +AL++L +V+KGWGQG ISS QPQR D+ D W+ Sbjct: 823 KHNRHGGNNWQNILHRDDGSGIALKSLSRVKKGWGQGDISSFQPQRVDYLDYWE 876