BLASTX nr result
ID: Panax24_contig00032600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00032600 (1521 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011069463.1 PREDICTED: ATP synthase subunit a, partial [Sesam... 69 9e-09 AAU90319.1 hypothetical protein SDM1_55t00005 [Solanum demissum] 59 1e-06 >XP_011069463.1 PREDICTED: ATP synthase subunit a, partial [Sesamum indicum] Length = 421 Score = 68.6 bits (166), Expect = 9e-09 Identities = 36/44 (81%), Positives = 37/44 (84%), Gaps = 3/44 (6%) Frame = +3 Query: 1377 YWLMIGFLLV---EFLPLALVPVSSRMSASILERMTWFHVAPLA 1499 YWLMI FLLV EFLPLALVPV SRM ASILERMTWFHVA L+ Sbjct: 367 YWLMIKFLLVLLVEFLPLALVPVLSRMPASILERMTWFHVATLS 410 >AAU90319.1 hypothetical protein SDM1_55t00005 [Solanum demissum] Length = 197 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 404 FLLSHRVSNKNTQQALALLEKDSIQPRVPLWLPCYDLTPVT 282 FL VSN+NTQQALAL EK+ IQP +P+ LPCYD TPVT Sbjct: 64 FLCREAVSNQNTQQALALPEKEVIQPHLPVRLPCYDFTPVT 104