BLASTX nr result
ID: Panax24_contig00032280
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00032280 (564 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019182768.1 PREDICTED: thioredoxin domain-containing protein ... 59 1e-08 CBI17460.3 unnamed protein product, partial [Vitis vinifera] 59 2e-08 XP_002276296.1 PREDICTED: thioredoxin domain-containing protein ... 59 2e-08 XP_016540487.1 PREDICTED: thioredoxin domain-containing protein ... 58 3e-08 XP_015890001.1 PREDICTED: thioredoxin domain-containing protein ... 58 5e-08 CAN68685.1 hypothetical protein VITISV_031964 [Vitis vinifera] 58 5e-08 XP_015889868.1 PREDICTED: thioredoxin domain-containing protein ... 58 5e-08 XP_010550425.1 PREDICTED: thioredoxin domain-containing protein ... 58 7e-08 XP_010550428.1 PREDICTED: thioredoxin domain-containing protein ... 58 7e-08 XP_012072892.1 PREDICTED: thioredoxin domain-containing protein ... 57 7e-08 KZV43229.1 hypothetical protein F511_39271 [Dorcoceras hygrometr... 57 7e-08 XP_008466737.1 PREDICTED: thioredoxin domain-containing protein ... 57 7e-08 XP_004149803.1 PREDICTED: thioredoxin domain-containing protein ... 57 7e-08 XP_011025847.1 PREDICTED: thioredoxin domain-containing protein ... 59 9e-08 XP_019254172.1 PREDICTED: thioredoxin domain-containing protein ... 58 9e-08 XP_009760050.1 PREDICTED: thioredoxin domain-containing protein ... 58 9e-08 XP_009611009.1 PREDICTED: thioredoxin domain-containing protein ... 58 9e-08 XP_019258985.1 PREDICTED: thioredoxin domain-containing protein ... 58 9e-08 XP_006827015.1 PREDICTED: thioredoxin domain-containing protein ... 60 1e-07 XP_010660204.1 PREDICTED: thioredoxin domain-containing protein ... 57 1e-07 >XP_019182768.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Ipomoea nil] Length = 229 Score = 59.3 bits (142), Expect(2) = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKFV+LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHFDTKFVKLDAENAPFFV 147 Score = 26.9 bits (58), Expect(2) = 1e-08 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C+ILFR Sbjct: 150 LGIKTLPCVILFR 162 >CBI17460.3 unnamed protein product, partial [Vitis vinifera] Length = 1021 Score = 58.9 bits (141), Expect(2) = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 909 IMDKHLKSLAPRHMDTKFIKLDAENAPFFV 938 Score = 26.6 bits (57), Expect(2) = 2e-08 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LG+KTL C+ILFR Sbjct: 941 LGVKTLPCVILFR 953 >XP_002276296.1 PREDICTED: thioredoxin domain-containing protein PLP3A [Vitis vinifera] Length = 230 Score = 58.9 bits (141), Expect(2) = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHMDTKFIKLDAENAPFFV 147 Score = 26.6 bits (57), Expect(2) = 2e-08 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LG+KTL C+ILFR Sbjct: 150 LGVKTLPCVILFR 162 >XP_016540487.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Capsicum annuum] XP_016540488.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Capsicum annuum] XP_016540489.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Capsicum annuum] Length = 228 Score = 58.2 bits (139), Expect(2) = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHVDTKFLKLDAENAPFFV 147 Score = 26.9 bits (58), Expect(2) = 3e-08 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C+ILFR Sbjct: 150 LGIKTLPCVILFR 162 >XP_015890001.1 PREDICTED: thioredoxin domain-containing protein PLP3B [Ziziphus jujuba] Length = 230 Score = 57.8 bits (138), Expect(2) = 5e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 IVDKHLKSLAPRH DTKF++L+AENAPFFV Sbjct: 118 IVDKHLKSLAPRHLDTKFIKLNAENAPFFV 147 Score = 26.6 bits (57), Expect(2) = 5e-08 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C++LFR Sbjct: 150 LGIKTLPCVVLFR 162 >CAN68685.1 hypothetical protein VITISV_031964 [Vitis vinifera] Length = 228 Score = 57.8 bits (138), Expect(2) = 5e-08 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = +3 Query: 213 VPLLVFSI--IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 + L+F I I+DKHLKSLAPRH DTK ++LDAENAPFFV Sbjct: 106 IVFLLFDISRIMDKHLKSLAPRHMDTKIIKLDAENAPFFV 145 Score = 26.6 bits (57), Expect(2) = 5e-08 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LG+KTL C+ILFR Sbjct: 148 LGVKTLPCVILFR 160 >XP_015889868.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like, partial [Ziziphus jujuba] Length = 202 Score = 57.8 bits (138), Expect(2) = 5e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 IVDKHLKSLAPRH DTKF++L+AENAPFFV Sbjct: 90 IVDKHLKSLAPRHLDTKFIKLNAENAPFFV 119 Score = 26.6 bits (57), Expect(2) = 5e-08 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C++LFR Sbjct: 122 LGIKTLPCVVLFR 134 >XP_010550425.1 PREDICTED: thioredoxin domain-containing protein PLP3B isoform X2 [Tarenaya hassleriana] Length = 238 Score = 57.8 bits (138), Expect(2) = 7e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLK+LAPRH DTKF++LDAENAPFFV Sbjct: 126 IMDKHLKALAPRHMDTKFIKLDAENAPFFV 155 Score = 26.2 bits (56), Expect(2) = 7e-08 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LG+KTL C++LFR Sbjct: 158 LGVKTLPCVVLFR 170 >XP_010550428.1 PREDICTED: thioredoxin domain-containing protein PLP3B isoform X4 [Tarenaya hassleriana] Length = 230 Score = 57.8 bits (138), Expect(2) = 7e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLK+LAPRH DTKF++LDAENAPFFV Sbjct: 118 IMDKHLKALAPRHMDTKFIKLDAENAPFFV 147 Score = 26.2 bits (56), Expect(2) = 7e-08 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LG+KTL C++LFR Sbjct: 150 LGVKTLPCVVLFR 162 >XP_012072892.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Jatropha curcas] KDP37464.1 hypothetical protein JCGZ_08305 [Jatropha curcas] Length = 230 Score = 57.0 bits (136), Expect(2) = 7e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLK+L+PRH DTKF+R+DAENAPFFV Sbjct: 118 IMDKHLKALSPRHVDTKFIRMDAENAPFFV 147 Score = 26.9 bits (58), Expect(2) = 7e-08 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C+ILFR Sbjct: 150 LGIKTLPCVILFR 162 >KZV43229.1 hypothetical protein F511_39271 [Dorcoceras hygrometricum] Length = 228 Score = 57.0 bits (136), Expect(2) = 7e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH +TKF++LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHFNTKFIKLDAENAPFFV 147 Score = 26.9 bits (58), Expect(2) = 7e-08 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C+ILFR Sbjct: 150 LGIKTLPCVILFR 162 >XP_008466737.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Cucumis melo] Length = 227 Score = 57.4 bits (137), Expect(2) = 7e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 IVDKHLK+LAP+H DTKF++LDAENAPFFV Sbjct: 118 IVDKHLKTLAPKHLDTKFIKLDAENAPFFV 147 Score = 26.6 bits (57), Expect(2) = 7e-08 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C++LFR Sbjct: 150 LGIKTLPCVVLFR 162 >XP_004149803.1 PREDICTED: thioredoxin domain-containing protein PLP3B [Cucumis sativus] KGN47705.1 hypothetical protein Csa_6G382930 [Cucumis sativus] Length = 227 Score = 57.4 bits (137), Expect(2) = 7e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 IVDKHLK+LAP+H DTKF++LDAENAPFFV Sbjct: 118 IVDKHLKTLAPKHLDTKFIKLDAENAPFFV 147 Score = 26.6 bits (57), Expect(2) = 7e-08 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C++LFR Sbjct: 150 LGIKTLPCVVLFR 162 >XP_011025847.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Populus euphratica] XP_011025848.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Populus euphratica] Length = 230 Score = 58.9 bits (141), Expect(2) = 9e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHVDTKFIKLDAENAPFFV 147 Score = 24.6 bits (52), Expect(2) = 9e-08 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 325 LGIKTLSCIILF 360 LG+KTL C+ILF Sbjct: 150 LGVKTLPCVILF 161 >XP_019254172.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana attenuata] XP_019254173.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana attenuata] OIS97490.1 thioredoxin domain-containing protein plp3b [Nicotiana attenuata] Length = 228 Score = 58.2 bits (139), Expect(2) = 9e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHVDTKFLKLDAENAPFFV 147 Score = 25.4 bits (54), Expect(2) = 9e-08 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C+I FR Sbjct: 150 LGIKTLPCVIFFR 162 >XP_009760050.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana sylvestris] XP_009760051.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana sylvestris] XP_016509246.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana tabacum] XP_016509247.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana tabacum] Length = 228 Score = 58.2 bits (139), Expect(2) = 9e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHVDTKFLKLDAENAPFFV 147 Score = 25.4 bits (54), Expect(2) = 9e-08 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C+I FR Sbjct: 150 LGIKTLPCVIFFR 162 >XP_009611009.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana tomentosiformis] XP_016480000.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana tabacum] XP_018629097.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana tomentosiformis] XP_018629098.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana tomentosiformis] Length = 228 Score = 58.2 bits (139), Expect(2) = 9e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHVDTKFLKLDAENAPFFV 147 Score = 25.4 bits (54), Expect(2) = 9e-08 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C+I FR Sbjct: 150 LGIKTLPCVIFFR 162 >XP_019258985.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana attenuata] XP_019258986.1 PREDICTED: thioredoxin domain-containing protein PLP3B-like [Nicotiana attenuata] Length = 227 Score = 58.2 bits (139), Expect(2) = 9e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 118 IMDKHLKSLAPRHVDTKFLKLDAENAPFFV 147 Score = 25.4 bits (54), Expect(2) = 9e-08 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LGIKTL C+I FR Sbjct: 150 LGIKTLPCVIFFR 162 >XP_006827015.1 PREDICTED: thioredoxin domain-containing protein PLP3A [Amborella trichopoda] ERM94252.1 hypothetical protein AMTR_s00010p00218390 [Amborella trichopoda] Length = 228 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 IVDKHLKSLAPRH DTKF++LDAENAPFFV Sbjct: 118 IVDKHLKSLAPRHVDTKFIKLDAENAPFFV 147 >XP_010660204.1 PREDICTED: thioredoxin domain-containing protein PLP3A isoform X1 [Vitis vinifera] Length = 255 Score = 56.6 bits (135), Expect(2) = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 237 IVDKHLKSLAPRHGDTKFVRLDAENAPFFV 326 I+DKHLKSLAPRH DTK ++LDAENAPFFV Sbjct: 143 IMDKHLKSLAPRHMDTKIIKLDAENAPFFV 172 Score = 26.6 bits (57), Expect(2) = 1e-07 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 325 LGIKTLSCIILFR 363 LG+KTL C+ILFR Sbjct: 175 LGVKTLPCVILFR 187