BLASTX nr result
ID: Panax24_contig00032179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00032179 (469 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019256065.1 PREDICTED: FIP1[V]-like protein [Nicotiana attenu... 41 4e-06 >XP_019256065.1 PREDICTED: FIP1[V]-like protein [Nicotiana attenuata] OIS97209.1 fip1[v]-like protein [Nicotiana attenuata] Length = 1378 Score = 40.8 bits (94), Expect(3) = 4e-06 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +2 Query: 65 ASLNVKEIDGHKKSGTSLANKLPD 136 +SLN+K+ID HK SGTSLANK PD Sbjct: 1257 SSLNMKDIDAHKSSGTSLANKNPD 1280 Score = 31.2 bits (69), Expect(3) = 4e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 1 LERWTSHKERDF 36 LERWTSHKERDF Sbjct: 1239 LERWTSHKERDF 1250 Score = 24.6 bits (52), Expect(3) = 4e-06 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 14/60 (23%) Frame = +1 Query: 214 DVEVKPMEDRHLDAS*LLQS*RNK--------------KKVENEPSPPLQIETCTDIETK 351 +VE K MED+HL+ L+ + KK E +P +Q E D E K Sbjct: 1306 NVEAKHMEDKHLETVEKLKKRSERFKLPMPSEKEAPVSKKAEGDPISSVQSEIPPDSEVK 1365