BLASTX nr result
ID: Panax24_contig00032172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00032172 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243571.1 PREDICTED: probable beta-1,4-xylosyltransferase I... 63 7e-09 CDP00965.1 unnamed protein product [Coffea canephora] 61 3e-08 KVH99668.1 Glycosyl transferase, family 43 [Cynara cardunculus v... 58 3e-07 >XP_017243571.1 PREDICTED: probable beta-1,4-xylosyltransferase IRX9H [Daucus carota subsp. sativus] KZM99799.1 hypothetical protein DCAR_012839 [Daucus carota subsp. sativus] Length = 387 Score = 62.8 bits (151), Expect = 7e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 310 MASIRRTLSPYHDRSYQNGGSPFSVQSPSHKN 405 MASIRR+LSPYHDRS+ NGGSPFSV SPSHKN Sbjct: 1 MASIRRSLSPYHDRSHTNGGSPFSVNSPSHKN 32 >CDP00965.1 unnamed protein product [Coffea canephora] Length = 386 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 310 MASIRRTLSPYHDRSYQNGGSPFSVQSPSHK 402 MASIRRTLSPYHDR YQNGG+PFSV+S SHK Sbjct: 1 MASIRRTLSPYHDRPYQNGGNPFSVESASHK 31 >KVH99668.1 Glycosyl transferase, family 43 [Cynara cardunculus var. scolymus] Length = 397 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +1 Query: 310 MASIRRTLSPYHDRSYQNGG--SPFSVQSPSHK 402 MASIRRTLSPYHDRS+QNGG SPFS+ SPSHK Sbjct: 1 MASIRRTLSPYHDRSHQNGGNTSPFSLNSPSHK 33