BLASTX nr result
ID: Panax24_contig00031930
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00031930 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [J... 62 1e-09 >YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [Jatropha curcas] ACN72735.1 ORF126 (chloroplast) [Jatropha curcas] ACN72751.1 ORF126 (chloroplast) [Jatropha curcas] Length = 126 Score = 61.6 bits (148), Expect = 1e-09 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 4/64 (6%) Frame = -2 Query: 379 TRITQDRLEIFGKIPAHNSADKVHYIVRFSFRG*RFTHSVTLVLDIP--KMVLSG--SPI 212 TR+ D +E GK+PA N DKVHYIVR FR R THSVTL LD+P K VLSG + I Sbjct: 25 TRVV-DTIETSGKMPARNPTDKVHYIVR--FRDWRLTHSVTLALDVPKRKWVLSGRVNSI 81 Query: 211 IDTC 200 ID C Sbjct: 82 IDVC 85