BLASTX nr result
ID: Panax24_contig00031923
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00031923 (474 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017258539.1 PREDICTED: metacaspase-3-like [Daucus carota subs... 65 1e-09 >XP_017258539.1 PREDICTED: metacaspase-3-like [Daucus carota subsp. sativus] Length = 402 Score = 65.5 bits (158), Expect = 1e-09 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 158 MATRKEKCICCSTKLRVPVDTQSIQCPACGSVIVVSQRNSAY 33 M+TRKEKC C TK+RVP++ QS+ CPACG+V VV +RNS Y Sbjct: 1 MSTRKEKCSWCRTKVRVPIEAQSVNCPACGTVFVVPRRNSGY 42