BLASTX nr result
ID: Panax24_contig00031823
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00031823 (387 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010667745.1 PREDICTED: callose synthase 12 [Beta vulgaris sub... 60 4e-08 XP_017246869.1 PREDICTED: callose synthase 12 [Daucus carota sub... 60 4e-08 XP_011086366.1 PREDICTED: callose synthase 12 [Sesamum indicum] 60 4e-08 KZV46367.1 callose synthase 12-like [Dorcoceras hygrometricum] 60 4e-08 XP_019159277.1 PREDICTED: callose synthase 12 [Ipomoea nil] 60 4e-08 XP_012847872.1 PREDICTED: callose synthase 12 [Erythranthe gutta... 60 8e-08 KYP44555.1 Callose synthase 12 [Cajanus cajan] 59 1e-07 KHN35252.1 Callose synthase 12 [Glycine soja] 59 1e-07 KHN31989.1 Callose synthase 12 [Glycine soja] 59 1e-07 XP_016188280.1 PREDICTED: callose synthase 12-like [Arachis ipae... 59 1e-07 OIV99243.1 hypothetical protein TanjilG_06548 [Lupinus angustifo... 59 1e-07 XP_015953847.1 PREDICTED: callose synthase 12-like [Arachis dura... 59 1e-07 XP_012572668.1 PREDICTED: callose synthase 12-like isoform X1 [C... 59 1e-07 XP_019413240.1 PREDICTED: callose synthase 12-like [Lupinus angu... 59 1e-07 XP_019449022.1 PREDICTED: callose synthase 12-like [Lupinus angu... 59 1e-07 XP_014493833.1 PREDICTED: callose synthase 12 [Vigna radiata var... 59 1e-07 XP_017432990.1 PREDICTED: callose synthase 12 [Vigna angularis] ... 59 1e-07 XP_007132658.1 hypothetical protein PHAVU_011G113800g [Phaseolus... 59 1e-07 XP_010097906.1 Callose synthase 12 [Morus notabilis] EXB72969.1 ... 59 1e-07 XP_003607458.1 callose synthase-like protein [Medicago truncatul... 59 1e-07 >XP_010667745.1 PREDICTED: callose synthase 12 [Beta vulgaris subsp. vulgaris] KMS95162.1 hypothetical protein BVRB_011730 [Beta vulgaris subsp. vulgaris] Length = 1760 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQLRLRFQFF SAIQFNLMPEEQLLN Sbjct: 564 IRNMQQLRLRFQFFASAIQFNLMPEEQLLN 593 >XP_017246869.1 PREDICTED: callose synthase 12 [Daucus carota subsp. sativus] KZM99629.1 hypothetical protein DCAR_013009 [Daucus carota subsp. sativus] Length = 1770 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQLRLRFQFF SAIQFNLMPEEQLLN Sbjct: 573 IRNMQQLRLRFQFFASAIQFNLMPEEQLLN 602 >XP_011086366.1 PREDICTED: callose synthase 12 [Sesamum indicum] Length = 1771 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQLRLRFQFF SAIQFNLMPEEQLLN Sbjct: 567 IRNMQQLRLRFQFFASAIQFNLMPEEQLLN 596 >KZV46367.1 callose synthase 12-like [Dorcoceras hygrometricum] Length = 1773 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQLRLRFQFF SAIQFNLMPEEQLLN Sbjct: 568 IRNMQQLRLRFQFFASAIQFNLMPEEQLLN 597 >XP_019159277.1 PREDICTED: callose synthase 12 [Ipomoea nil] Length = 1780 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQLRLRFQFF SAIQFNLMPEEQLLN Sbjct: 584 IRNMQQLRLRFQFFASAIQFNLMPEEQLLN 613 >XP_012847872.1 PREDICTED: callose synthase 12 [Erythranthe guttata] EYU28588.1 hypothetical protein MIMGU_mgv1a000108mg [Erythranthe guttata] Length = 1770 Score = 59.7 bits (143), Expect = 8e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQLRLRFQFF SAIQFNLMPEEQL+N Sbjct: 568 IRNMQQLRLRFQFFASAIQFNLMPEEQLMN 597 >KYP44555.1 Callose synthase 12 [Cajanus cajan] Length = 1482 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 506 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 535 >KHN35252.1 Callose synthase 12 [Glycine soja] Length = 1665 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 474 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 503 >KHN31989.1 Callose synthase 12 [Glycine soja] Length = 1669 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 477 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 506 >XP_016188280.1 PREDICTED: callose synthase 12-like [Arachis ipaensis] Length = 1701 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 510 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 539 >OIV99243.1 hypothetical protein TanjilG_06548 [Lupinus angustifolius] Length = 1741 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 576 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 605 >XP_015953847.1 PREDICTED: callose synthase 12-like [Arachis duranensis] Length = 1745 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 579 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 608 >XP_012572668.1 PREDICTED: callose synthase 12-like isoform X1 [Cicer arietinum] XP_012572669.1 PREDICTED: callose synthase 12-like isoform X2 [Cicer arietinum] XP_012572670.1 PREDICTED: callose synthase 12-like isoform X3 [Cicer arietinum] XP_012572671.1 PREDICTED: callose synthase 12-like isoform X1 [Cicer arietinum] Length = 1766 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 574 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 603 >XP_019413240.1 PREDICTED: callose synthase 12-like [Lupinus angustifolius] Length = 1768 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 576 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 605 >XP_019449022.1 PREDICTED: callose synthase 12-like [Lupinus angustifolius] XP_019449023.1 PREDICTED: callose synthase 12-like [Lupinus angustifolius] XP_019449024.1 PREDICTED: callose synthase 12-like [Lupinus angustifolius] OIW08367.1 hypothetical protein TanjilG_03043 [Lupinus angustifolius] Length = 1768 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 576 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 605 >XP_014493833.1 PREDICTED: callose synthase 12 [Vigna radiata var. radiata] Length = 1769 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 577 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 606 >XP_017432990.1 PREDICTED: callose synthase 12 [Vigna angularis] KOM50310.1 hypothetical protein LR48_Vigan08g113700 [Vigna angularis] BAT90130.1 hypothetical protein VIGAN_06131300 [Vigna angularis var. angularis] Length = 1769 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 577 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 606 >XP_007132658.1 hypothetical protein PHAVU_011G113800g [Phaseolus vulgaris] ESW04652.1 hypothetical protein PHAVU_011G113800g [Phaseolus vulgaris] Length = 1769 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 577 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 606 >XP_010097906.1 Callose synthase 12 [Morus notabilis] EXB72969.1 Callose synthase 12 [Morus notabilis] Length = 1774 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRN+QQLRLRFQFF SAIQFNLMPEEQLLN Sbjct: 578 IRNLQQLRLRFQFFASAIQFNLMPEEQLLN 607 >XP_003607458.1 callose synthase-like protein [Medicago truncatula] AES89655.1 callose synthase-like protein [Medicago truncatula] Length = 1815 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 95 IRNMQQLRLRFQFFVSAIQFNLMPEEQLLN 6 IRNMQQL+LRFQFF SAIQFNLMPEEQLLN Sbjct: 571 IRNMQQLKLRFQFFASAIQFNLMPEEQLLN 600