BLASTX nr result
ID: Panax24_contig00030983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00030983 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM97114.1 hypothetical protein DCAR_015524 [Daucus carota subsp... 73 5e-14 >KZM97114.1 hypothetical protein DCAR_015524 [Daucus carota subsp. sativus] Length = 95 Score = 72.8 bits (177), Expect = 5e-14 Identities = 41/64 (64%), Positives = 49/64 (76%), Gaps = 5/64 (7%) Frame = -2 Query: 307 LVFVLALL---MMSSCLSFNLKALMAEMNFND-EQRKLLAAEGSNSVHPGTN-DLNNHHY 143 LVFVL LL +M+S +S N+K+LMAEMN +D E RKL A GSNS HPG N D+NNHH+ Sbjct: 7 LVFVLPLLITMLMNSGMSMNVKSLMAEMNLHDIEVRKLSAVAGSNSEHPGVNSDVNNHHF 66 Query: 142 IPRQ 131 IPRQ Sbjct: 67 IPRQ 70