BLASTX nr result
ID: Panax24_contig00030978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00030978 (573 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV67418.1 zf-C3HC4_2 domain-containing protein [Cephalotus foll... 84 4e-20 XP_017244643.1 PREDICTED: nitric oxide synthase-interacting prot... 83 4e-20 KYP39917.1 Nitric oxide synthase-interacting protein [Cajanus ca... 81 2e-19 KVH93653.1 Nitric oxide synthase-interacting [Cynara cardunculus... 80 2e-19 XP_017436471.1 PREDICTED: nitric oxide synthase-interacting prot... 80 2e-19 XP_017436472.1 PREDICTED: nitric oxide synthase-interacting prot... 80 2e-19 KHN33635.1 Nitric oxide synthase-interacting protein [Glycine soja] 80 4e-19 XP_007148264.1 hypothetical protein PHAVU_006G193700g [Phaseolus... 81 4e-19 XP_003545809.1 PREDICTED: nitric oxide synthase-interacting prot... 80 4e-19 KHN19093.1 Nitric oxide synthase-interacting protein [Glycine so... 80 4e-19 NP_001304360.1 nitric oxide synthase-interacting protein-like [G... 80 4e-19 XP_008224914.1 PREDICTED: nitric oxide synthase-interacting prot... 81 5e-19 XP_007211688.1 hypothetical protein PRUPE_ppa009151mg [Prunus pe... 81 5e-19 CDP14177.1 unnamed protein product [Coffea canephora] 79 5e-19 CBI40874.3 unnamed protein product, partial [Vitis vinifera] 79 7e-19 XP_014519146.1 PREDICTED: nitric oxide synthase-interacting prot... 80 7e-19 XP_004139773.1 PREDICTED: nitric oxide synthase-interacting prot... 79 7e-19 XP_002272953.1 PREDICTED: nitric oxide synthase-interacting prot... 79 7e-19 XP_009372652.1 PREDICTED: nitric oxide synthase-interacting prot... 81 7e-19 XP_008371243.1 PREDICTED: nitric oxide synthase-interacting prot... 81 7e-19 >GAV67418.1 zf-C3HC4_2 domain-containing protein [Cephalotus follicularis] Length = 304 Score = 84.3 bits (207), Expect(2) = 4e-20 Identities = 45/62 (72%), Positives = 47/62 (75%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LSSCGHVFCKK C DKFMAVDKVCLVCNKGCKERNLV NL+ G Sbjct: 216 SCKVTLTNTLSLVTLSSCGHVFCKK-CADKFMAVDKVCLVCNKGCKERNLV--NLEKGGT 272 Query: 412 WF 407 F Sbjct: 273 GF 274 Score = 41.2 bits (95), Expect(2) = 4e-20 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSG+GLGLVRPAMKT Sbjct: 286 FKHLGSGTGLGLVRPAMKT 304 >XP_017244643.1 PREDICTED: nitric oxide synthase-interacting protein-like [Daucus carota subsp. sativus] KZN11505.1 hypothetical protein DCAR_004161 [Daucus carota subsp. sativus] Length = 304 Score = 83.2 bits (204), Expect(2) = 4e-20 Identities = 45/69 (65%), Positives = 48/69 (69%), Gaps = 19/69 (27%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV--------- 440 SCKVT+T LSSCGHVFCKK C DKFMAVDKVCLVCNKGCKE+NLV Sbjct: 216 SCKVTITNTIALVALSSCGHVFCKK-CADKFMAVDKVCLVCNKGCKEKNLVPLEKGGTGF 274 Query: 439 ---GDNLQA 422 GDNL+A Sbjct: 275 SAHGDNLEA 283 Score = 42.4 bits (98), Expect(2) = 4e-20 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >KYP39917.1 Nitric oxide synthase-interacting protein [Cajanus cajan] Length = 304 Score = 80.9 bits (198), Expect(2) = 2e-19 Identities = 43/62 (69%), Positives = 46/62 (74%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LSSCGHVFCKK C D+FMAVDKVCLVCNK CKERNLV NL+ G Sbjct: 216 SCKVTLTNTMSLVALSSCGHVFCKK-CADRFMAVDKVCLVCNKACKERNLV--NLEKGGT 272 Query: 412 WF 407 F Sbjct: 273 GF 274 Score = 42.4 bits (98), Expect(2) = 2e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >KVH93653.1 Nitric oxide synthase-interacting [Cynara cardunculus var. scolymus] Length = 304 Score = 80.5 bits (197), Expect(2) = 2e-19 Identities = 43/69 (62%), Positives = 46/69 (66%), Gaps = 19/69 (27%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV--------- 440 SCKVT+T LSSCGHVFCKK C DKFM VDKVCLVCNK CKERNL+ Sbjct: 216 SCKVTLTNTLALVGLSSCGHVFCKK-CADKFMVVDKVCLVCNKACKERNLINLEKGGTGF 274 Query: 439 ---GDNLQA 422 GDNL+A Sbjct: 275 AGHGDNLEA 283 Score = 42.4 bits (98), Expect(2) = 2e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >XP_017436471.1 PREDICTED: nitric oxide synthase-interacting protein-like [Vigna angularis] KOM53863.1 hypothetical protein LR48_Vigan09g252200 [Vigna angularis] BAT86994.1 hypothetical protein VIGAN_05032900 [Vigna angularis var. angularis] Length = 304 Score = 80.5 bits (197), Expect(2) = 2e-19 Identities = 44/69 (63%), Positives = 47/69 (68%), Gaps = 19/69 (27%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV--------- 440 SCKVT+T LSSCGHVFCKK C D+FMAVDKVCLVCNK CKERNLV Sbjct: 216 SCKVTLTNTMSLVALSSCGHVFCKK-CADRFMAVDKVCLVCNKACKERNLVSLEKGGTGF 274 Query: 439 ---GDNLQA 422 GD+LQA Sbjct: 275 AGHGDHLQA 283 Score = 42.4 bits (98), Expect(2) = 2e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >XP_017436472.1 PREDICTED: nitric oxide synthase-interacting protein homolog [Vigna angularis] Length = 204 Score = 80.5 bits (197), Expect(2) = 2e-19 Identities = 44/69 (63%), Positives = 47/69 (68%), Gaps = 19/69 (27%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV--------- 440 SCKVT+T LSSCGHVFCKK C D+FMAVDKVCLVCNK CKERNLV Sbjct: 116 SCKVTLTNTMSLVALSSCGHVFCKK-CADRFMAVDKVCLVCNKACKERNLVSLEKGGTGF 174 Query: 439 ---GDNLQA 422 GD+LQA Sbjct: 175 AGHGDHLQA 183 Score = 42.4 bits (98), Expect(2) = 2e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 186 FKHLGSGSGLGLVRPAMKT 204 >KHN33635.1 Nitric oxide synthase-interacting protein [Glycine soja] Length = 324 Score = 79.7 bits (195), Expect(2) = 4e-19 Identities = 42/62 (67%), Positives = 46/62 (74%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LS+CGHVFCKK C D+FMAVDKVCLVCNK CKERNLV NL+ G Sbjct: 236 SCKVTLTNTMSLVALSTCGHVFCKK-CADRFMAVDKVCLVCNKACKERNLV--NLEKGGT 292 Query: 412 WF 407 F Sbjct: 293 GF 294 Score = 42.4 bits (98), Expect(2) = 4e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 306 FKHLGSGSGLGLVRPAMKT 324 >XP_007148264.1 hypothetical protein PHAVU_006G193700g [Phaseolus vulgaris] ESW20258.1 hypothetical protein PHAVU_006G193700g [Phaseolus vulgaris] Length = 304 Score = 80.9 bits (198), Expect(2) = 4e-19 Identities = 43/62 (69%), Positives = 46/62 (74%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LSSCGHVFCKK C D+FMAVDKVCLVCNK CKERNLV NL+ G Sbjct: 216 SCKVTLTNTMSLVALSSCGHVFCKK-CADRFMAVDKVCLVCNKACKERNLV--NLEKGGT 272 Query: 412 WF 407 F Sbjct: 273 GF 274 Score = 41.2 bits (95), Expect(2) = 4e-19 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSG+GLGLVRPAMKT Sbjct: 286 FKHLGSGTGLGLVRPAMKT 304 >XP_003545809.1 PREDICTED: nitric oxide synthase-interacting protein-like [Glycine max] KRH10725.1 hypothetical protein GLYMA_15G066000 [Glycine max] Length = 304 Score = 79.7 bits (195), Expect(2) = 4e-19 Identities = 42/62 (67%), Positives = 46/62 (74%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LS+CGHVFCKK C D+FMAVDKVCLVCNK CKERNLV NL+ G Sbjct: 216 SCKVTLTNTMSLVALSTCGHVFCKK-CADRFMAVDKVCLVCNKACKERNLV--NLEKGGT 272 Query: 412 WF 407 F Sbjct: 273 GF 274 Score = 42.4 bits (98), Expect(2) = 4e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >KHN19093.1 Nitric oxide synthase-interacting protein [Glycine soja] KRH21596.1 hypothetical protein GLYMA_13G247800 [Glycine max] Length = 304 Score = 79.7 bits (195), Expect(2) = 4e-19 Identities = 42/62 (67%), Positives = 46/62 (74%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LS+CGHVFCKK C D+FMAVDKVCLVCNK CKERNLV NL+ G Sbjct: 216 SCKVTLTNTMSLVALSTCGHVFCKK-CADRFMAVDKVCLVCNKACKERNLV--NLEKGGT 272 Query: 412 WF 407 F Sbjct: 273 GF 274 Score = 42.4 bits (98), Expect(2) = 4e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >NP_001304360.1 nitric oxide synthase-interacting protein-like [Glycine max] ACU20978.1 unknown [Glycine max] Length = 304 Score = 79.7 bits (195), Expect(2) = 4e-19 Identities = 42/62 (67%), Positives = 46/62 (74%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LS+CGHVFCKK C D+FMAVDKVCLVCNK CKERNLV NL+ G Sbjct: 216 SCKVTLTNTMSLVALSTCGHVFCKK-CADRFMAVDKVCLVCNKACKERNLV--NLEKGGT 272 Query: 412 WF 407 F Sbjct: 273 GF 274 Score = 42.4 bits (98), Expect(2) = 4e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >XP_008224914.1 PREDICTED: nitric oxide synthase-interacting protein homolog [Prunus mume] Length = 304 Score = 80.9 bits (198), Expect(2) = 5e-19 Identities = 44/69 (63%), Positives = 48/69 (69%), Gaps = 19/69 (27%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV--------- 440 SCKVT+T LSSCGHVFCKK C DKFMAVDKVCLVC+KGCKER+LV Sbjct: 216 SCKVTLTNTMSLVALSSCGHVFCKK-CADKFMAVDKVCLVCDKGCKERHLVNLAKGGTGF 274 Query: 439 ---GDNLQA 422 GDNL+A Sbjct: 275 AGHGDNLEA 283 Score = 40.8 bits (94), Expect(2) = 5e-19 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPA+KT Sbjct: 286 FKHLGSGSGLGLVRPAVKT 304 >XP_007211688.1 hypothetical protein PRUPE_ppa009151mg [Prunus persica] ONI10191.1 hypothetical protein PRUPE_4G033800 [Prunus persica] Length = 304 Score = 80.9 bits (198), Expect(2) = 5e-19 Identities = 44/69 (63%), Positives = 48/69 (69%), Gaps = 19/69 (27%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV--------- 440 SCKVT+T LSSCGHVFCKK C DKFMAVDKVCLVC+KGCKER+LV Sbjct: 216 SCKVTLTNTMSLVALSSCGHVFCKK-CADKFMAVDKVCLVCDKGCKERHLVNLAKGGTGF 274 Query: 439 ---GDNLQA 422 GDNL+A Sbjct: 275 AGHGDNLEA 283 Score = 40.8 bits (94), Expect(2) = 5e-19 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPA+KT Sbjct: 286 FKHLGSGSGLGLVRPAVKT 304 >CDP14177.1 unnamed protein product [Coffea canephora] Length = 304 Score = 79.3 bits (194), Expect(2) = 5e-19 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 7/51 (13%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV 440 SCKVT+T L+SCGHVFCKK CG+KFMAVDKVCLVCNK CKERNLV Sbjct: 216 SCKVTLTNTVALMALNSCGHVFCKK-CGEKFMAVDKVCLVCNKPCKERNLV 265 Score = 42.4 bits (98), Expect(2) = 5e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >CBI40874.3 unnamed protein product, partial [Vitis vinifera] Length = 376 Score = 79.0 bits (193), Expect(2) = 7e-19 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 7/51 (13%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV 440 SCKVT+T LSSCGHVFCKK C KFMAVDKVCLVCNKGCK+RNLV Sbjct: 288 SCKVTLTNTMSLVALSSCGHVFCKK-CAGKFMAVDKVCLVCNKGCKDRNLV 337 Score = 42.4 bits (98), Expect(2) = 7e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 358 FKHLGSGSGLGLVRPAMKT 376 >XP_014519146.1 PREDICTED: nitric oxide synthase-interacting protein [Vigna radiata var. radiata] Length = 304 Score = 80.1 bits (196), Expect(2) = 7e-19 Identities = 43/69 (62%), Positives = 47/69 (68%), Gaps = 19/69 (27%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV--------- 440 SCKVT+T LSSCGH+FCKK C D+FMAVDKVCLVCNK CKERNLV Sbjct: 216 SCKVTLTNTMSLVALSSCGHIFCKK-CADRFMAVDKVCLVCNKACKERNLVSLEKGGTGF 274 Query: 439 ---GDNLQA 422 GD+LQA Sbjct: 275 AGHGDHLQA 283 Score = 41.2 bits (95), Expect(2) = 7e-19 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSG+GLGLVRPAMKT Sbjct: 286 FKHLGSGTGLGLVRPAMKT 304 >XP_004139773.1 PREDICTED: nitric oxide synthase-interacting protein [Cucumis sativus] XP_011658954.1 PREDICTED: nitric oxide synthase-interacting protein [Cucumis sativus] KGN44119.1 hypothetical protein Csa_7G195280 [Cucumis sativus] Length = 304 Score = 79.0 bits (193), Expect(2) = 7e-19 Identities = 42/62 (67%), Positives = 45/62 (72%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T L +CGHVFCKK C DKFMAVDKVCLVCNKGCK RNLV NL+ G Sbjct: 216 SCKVTLTNTMALVALGTCGHVFCKK-CADKFMAVDKVCLVCNKGCKVRNLV--NLEKGGT 272 Query: 412 WF 407 F Sbjct: 273 GF 274 Score = 42.4 bits (98), Expect(2) = 7e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >XP_002272953.1 PREDICTED: nitric oxide synthase-interacting protein [Vitis vinifera] XP_010646367.1 PREDICTED: nitric oxide synthase-interacting protein [Vitis vinifera] Length = 304 Score = 79.0 bits (193), Expect(2) = 7e-19 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 7/51 (13%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLV 440 SCKVT+T LSSCGHVFCKK C KFMAVDKVCLVCNKGCK+RNLV Sbjct: 216 SCKVTLTNTMSLVALSSCGHVFCKK-CAGKFMAVDKVCLVCNKGCKDRNLV 265 Score = 42.4 bits (98), Expect(2) = 7e-19 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPAMKT Sbjct: 286 FKHLGSGSGLGLVRPAMKT 304 >XP_009372652.1 PREDICTED: nitric oxide synthase-interacting protein [Pyrus x bretschneideri] Length = 303 Score = 81.3 bits (199), Expect(2) = 7e-19 Identities = 44/62 (70%), Positives = 46/62 (74%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LSSCGHVFCKK C DKFMAVDKVCLVC+KGCKERNLV NL G Sbjct: 215 SCKVTLTNTLSLVALSSCGHVFCKK-CADKFMAVDKVCLVCSKGCKERNLV--NLAKGGT 271 Query: 412 WF 407 F Sbjct: 272 GF 273 Score = 40.0 bits (92), Expect(2) = 7e-19 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPA KT Sbjct: 285 FKHLGSGSGLGLVRPAAKT 303 >XP_008371243.1 PREDICTED: nitric oxide synthase-interacting protein-like [Malus domestica] XP_008355975.1 PREDICTED: nitric oxide synthase-interacting protein-like [Malus domestica] XP_008364123.1 PREDICTED: nitric oxide synthase-interacting protein-like [Malus domestica] Length = 303 Score = 81.3 bits (199), Expect(2) = 7e-19 Identities = 44/62 (70%), Positives = 46/62 (74%), Gaps = 7/62 (11%) Frame = -3 Query: 571 SCKVTMT-------LSSCGHVFCKKKCGDKFMAVDKVCLVCNKGCKERNLVGDNLQAFGE 413 SCKVT+T LSSCGHVFCKK C DKFMAVDKVCLVC+KGCKERNLV NL G Sbjct: 215 SCKVTLTNTLSLVALSSCGHVFCKK-CADKFMAVDKVCLVCSKGCKERNLV--NLAKGGT 271 Query: 412 WF 407 F Sbjct: 272 GF 273 Score = 40.0 bits (92), Expect(2) = 7e-19 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 429 FKHLGSGSGLGLVRPAMKT 373 FKHLGSGSGLGLVRPA KT Sbjct: 285 FKHLGSGSGLGLVRPAAKT 303