BLASTX nr result
ID: Panax24_contig00030675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00030675 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF27612.1 conserved hypothetical protein [Ricinus communis] 69 7e-13 XP_013442834.1 hypothetical protein MTR_0082s0190 [Medicago trun... 65 6e-11 >EEF27612.1 conserved hypothetical protein [Ricinus communis] Length = 68 Score = 69.3 bits (168), Expect = 7e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 384 SLPWGVINVGRSVNAEAEPSAAAGVPLPQYMLSG 283 +LPWGVINVGRSVNAEAEPSAAAGVP PQYMLSG Sbjct: 7 ALPWGVINVGRSVNAEAEPSAAAGVPFPQYMLSG 40 >XP_013442834.1 hypothetical protein MTR_0082s0190 [Medicago truncatula] KEH16859.1 hypothetical protein MTR_0082s0190 [Medicago truncatula] Length = 109 Score = 65.5 bits (158), Expect = 6e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 378 PWGVINVGRSVNAEAEPSAAAGVPLPQYMLSG 283 PWGVIN+GRSVN EAEPSAAAGVP PQYMLSG Sbjct: 9 PWGVINIGRSVNTEAEPSAAAGVPFPQYMLSG 40