BLASTX nr result
ID: Panax24_contig00030277
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00030277 (475 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KQK85826.1 hypothetical protein SETIT_020742mg [Setaria italica] 55 2e-07 >KQK85826.1 hypothetical protein SETIT_020742mg [Setaria italica] Length = 74 Score = 55.1 bits (131), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 68 LCRKDGRVVESVASELLCRLLFTEGSNPQKHIS 166 LCR+DGRVV+ VA ELLCRLLFTEGSNP +S Sbjct: 28 LCRRDGRVVQGVALELLCRLLFTEGSNPSLSVS 60