BLASTX nr result
ID: Panax24_contig00030243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00030243 (454 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244721.1 PREDICTED: protein MKS1-like [Daucus carota subsp... 70 5e-12 >XP_017244721.1 PREDICTED: protein MKS1-like [Daucus carota subsp. sativus] KZM98293.1 hypothetical protein DCAR_014345 [Daucus carota subsp. sativus] Length = 200 Score = 70.1 bits (170), Expect = 5e-12 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -2 Query: 453 ATLPPIQPGFFSPGFDLSLLNDLSPFLNNMFSPSPKSLFSAPMV 322 A+L PI G FSPGFD+SLLN++SPFL+NMF+PSP SL +APMV Sbjct: 141 ASLAPISAGMFSPGFDMSLLNEMSPFLSNMFTPSPSSLLAAPMV 184