BLASTX nr result
ID: Panax24_contig00030233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00030233 (614 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB06939.1 hypothetical protein B456_001G226200 [Gossypium raimo... 69 5e-11 >KJB06939.1 hypothetical protein B456_001G226200 [Gossypium raimondii] Length = 215 Score = 69.3 bits (168), Expect = 5e-11 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -3 Query: 612 IKVGIMILELNTQRSTTRRKGSMMEMKILMAFTNTRKVSTRAQRLMRWVQ 463 I+VGIMIL L TQ+ST +RKGSMMEMKIL+ FT+T+KVS +AQ+LM+ VQ Sbjct: 164 IEVGIMILVLITQKSTMKRKGSMMEMKILVMFTDTKKVSIKAQKLMKLVQ 213