BLASTX nr result
ID: Panax24_contig00029953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029953 (540 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016562731.1 PREDICTED: regulator of telomere elongation helic... 56 7e-06 XP_016562730.1 PREDICTED: regulator of telomere elongation helic... 56 7e-06 XP_016562728.1 PREDICTED: regulator of telomere elongation helic... 56 7e-06 >XP_016562731.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X3 [Capsicum annuum] Length = 869 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 540 DRLPLLQRFKDYVPAKYQSLYEQYLN*TFEVEG 442 DRLPLL RFKDYVPAKY SLY+QYL T EV G Sbjct: 836 DRLPLLHRFKDYVPAKYHSLYDQYLKRTHEVAG 868 >XP_016562730.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X2 [Capsicum annuum] Length = 1032 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 540 DRLPLLQRFKDYVPAKYQSLYEQYLN*TFEVEG 442 DRLPLL RFKDYVPAKY SLY+QYL T EV G Sbjct: 999 DRLPLLHRFKDYVPAKYHSLYDQYLKRTHEVAG 1031 >XP_016562728.1 PREDICTED: regulator of telomere elongation helicase 1 isoform X1 [Capsicum annuum] Length = 1040 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 540 DRLPLLQRFKDYVPAKYQSLYEQYLN*TFEVEG 442 DRLPLL RFKDYVPAKY SLY+QYL T EV G Sbjct: 1007 DRLPLLHRFKDYVPAKYHSLYDQYLKRTHEVAG 1039