BLASTX nr result
ID: Panax24_contig00029921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029921 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP68207.1 UDP-glucuronic acid decarboxylase 1 [Cajanus cajan] 70 6e-13 AFK45364.1 unknown [Medicago truncatula] 66 2e-12 XP_011101753.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [S... 71 4e-12 JAU97340.1 UDP-glucuronic acid decarboxylase 5, partial [Noccaea... 68 5e-12 XP_011027159.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-li... 70 8e-12 XP_002315231.1 thymidine diphospho-glucose 4-6-dehydratase famil... 70 8e-12 XP_012065004.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 is... 70 8e-12 EYU25871.1 hypothetical protein MIMGU_mgv1a0229061mg, partial [E... 68 1e-11 XP_015074621.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-li... 70 1e-11 XP_006345947.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-li... 70 1e-11 KYP68206.1 UDP-glucuronic acid decarboxylase 1 [Cajanus cajan] 70 1e-11 XP_012089497.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-li... 70 1e-11 XP_017221895.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [D... 69 2e-11 XP_016572198.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-li... 69 2e-11 AEH04658.1 UDP-glucuronate decarboxylase [Camellia oleifera] 69 2e-11 NP_001240928.1 uncharacterized protein LOC100819843 [Glycine max... 69 2e-11 XP_009759288.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-li... 69 2e-11 XP_011469795.1 PREDICTED: UDP-glucuronic acid decarboxylase 5-li... 69 3e-11 AAB68605.1 thymidine diphospho-glucose 4-6-dehydratase homolog, ... 68 3e-11 KJB55911.1 hypothetical protein B456_009G100900 [Gossypium raimo... 68 4e-11 >KYP68207.1 UDP-glucuronic acid decarboxylase 1 [Cajanus cajan] Length = 124 Score = 69.7 bits (169), Expect = 6e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQRN 186 ITKAKELLGWEPK+KLRDGLPLMEEDFR RLG+ +N Sbjct: 88 ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVPKN 123 >AFK45364.1 unknown [Medicago truncatula] Length = 52 Score = 66.2 bits (160), Expect = 2e-12 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKA ELLGWEPK+KLRDGLPLMEEDFR RLG+ R Sbjct: 16 ITKATELLGWEPKVKLRDGLPLMEEDFRLRLGVPR 50 >XP_011101753.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum] XP_011101754.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum] XP_011101755.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum] XP_011101756.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum] XP_011101757.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum] Length = 346 Score = 70.9 bits (172), Expect = 4e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPKIKLRDG+PLMEEDFRKRLGI R Sbjct: 310 ITKAKELLGWEPKIKLRDGIPLMEEDFRKRLGILR 344 >JAU97340.1 UDP-glucuronic acid decarboxylase 5, partial [Noccaea caerulescens] Length = 162 Score = 68.2 bits (165), Expect = 5e-12 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQRN 186 ITKAKE+LGWEPK+KLR+GLPLMEEDFR+RLG+ +N Sbjct: 127 ITKAKEVLGWEPKVKLREGLPLMEEDFRQRLGVPKN 162 >XP_011027159.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Populus euphratica] XP_011027160.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Populus euphratica] XP_011027161.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Populus euphratica] Length = 346 Score = 70.1 bits (170), Expect = 8e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPKIKLRDGLPLMEEDFR+RLG+ R Sbjct: 310 ITKAKELLGWEPKIKLRDGLPLMEEDFRQRLGVPR 344 >XP_002315231.1 thymidine diphospho-glucose 4-6-dehydratase family protein [Populus trichocarpa] XP_006378724.1 hypothetical protein POPTR_0010s21420g [Populus trichocarpa] ABK93800.1 unknown [Populus trichocarpa] ABK94518.1 unknown [Populus trichocarpa] EEF01402.1 thymidine diphospho-glucose 4-6-dehydratase family protein [Populus trichocarpa] ERP56521.1 hypothetical protein POPTR_0010s21420g [Populus trichocarpa] Length = 346 Score = 70.1 bits (170), Expect = 8e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPKIKLRDGLPLMEEDFR+RLG+ R Sbjct: 310 ITKAKELLGWEPKIKLRDGLPLMEEDFRQRLGVPR 344 >XP_012065004.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X1 [Jatropha curcas] XP_012065005.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X2 [Jatropha curcas] XP_012065006.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X2 [Jatropha curcas] KDP44213.1 hypothetical protein JCGZ_05680 [Jatropha curcas] Length = 347 Score = 70.1 bits (170), Expect = 8e-12 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPK+KLRDGLPLMEEDFRKRLG+ + Sbjct: 311 ITKAKELLGWEPKVKLRDGLPLMEEDFRKRLGVPK 345 >EYU25871.1 hypothetical protein MIMGU_mgv1a0229061mg, partial [Erythranthe guttata] Length = 206 Score = 68.2 bits (165), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQRN 186 ITKAKELLGWEPKIKLR+G+PLMEEDFR+RLGI N Sbjct: 169 ITKAKELLGWEPKIKLREGIPLMEEDFRQRLGIPSN 204 >XP_015074621.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Solanum pennellii] Length = 343 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPK+KLRDGLPLMEEDFR RLGI R Sbjct: 307 ITKAKELLGWEPKVKLRDGLPLMEEDFRDRLGISR 341 >XP_006345947.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Solanum tuberosum] XP_006345948.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Solanum tuberosum] Length = 343 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPK+KLRDGLPLMEEDFR RLGI R Sbjct: 307 ITKAKELLGWEPKVKLRDGLPLMEEDFRDRLGISR 341 >KYP68206.1 UDP-glucuronic acid decarboxylase 1 [Cajanus cajan] Length = 346 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQRN 186 ITKAKELLGWEPK+KLRDGLPLMEEDFR RLG+ +N Sbjct: 310 ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVPKN 345 >XP_012089497.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Jatropha curcas] XP_012089501.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Jatropha curcas] KDP44990.1 hypothetical protein JCGZ_01490 [Jatropha curcas] Length = 346 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPK+KLRDGLPLMEEDFR+RLG+ R Sbjct: 310 ITKAKELLGWEPKVKLRDGLPLMEEDFRQRLGVPR 344 >XP_017221895.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Daucus carota subsp. sativus] XP_017221897.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Daucus carota subsp. sativus] XP_017221898.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Daucus carota subsp. sativus] XP_017221899.1 PREDICTED: UDP-glucuronic acid decarboxylase 6 [Daucus carota subsp. sativus] KZM84928.1 hypothetical protein DCAR_027650 [Daucus carota subsp. sativus] Length = 342 Score = 69.3 bits (168), Expect = 2e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKE+LGWEPK+KLRDGLPLME DFR+RLGIQR Sbjct: 306 ITKAKEVLGWEPKVKLRDGLPLMESDFRERLGIQR 340 >XP_016572198.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Capsicum annuum] XP_016572199.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Capsicum annuum] XP_016572200.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Capsicum annuum] Length = 343 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPK+KLRDGLPLMEEDFR RLGI R Sbjct: 307 ITKAKELLGWEPKVKLRDGLPLMEEDFRGRLGISR 341 >AEH04658.1 UDP-glucuronate decarboxylase [Camellia oleifera] Length = 340 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQRNA 183 ITKAKELLGWEPKIKLRDGLP MEEDFR+RLG+ + A Sbjct: 304 ITKAKELLGWEPKIKLRDGLPFMEEDFRQRLGVPKKA 340 >NP_001240928.1 uncharacterized protein LOC100819843 [Glycine max] XP_006591914.1 PREDICTED: uncharacterized protein LOC100819843 isoform X1 [Glycine max] XP_006591915.1 PREDICTED: uncharacterized protein LOC100819843 isoform X1 [Glycine max] ACU23582.1 unknown [Glycine max] KHN32113.1 UDP-glucuronic acid decarboxylase 1 [Glycine soja] KRH24820.1 hypothetical protein GLYMA_12G064600 [Glycine max] KRH24821.1 hypothetical protein GLYMA_12G064600 [Glycine max] KRH24822.1 hypothetical protein GLYMA_12G064600 [Glycine max] Length = 342 Score = 68.9 bits (167), Expect = 2e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQRN 186 ITKAKELLGWEPK+KLRDGLPLMEEDFR+RLG+ ++ Sbjct: 306 ITKAKELLGWEPKVKLRDGLPLMEEDFRQRLGVPKS 341 >XP_009759288.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana sylvestris] XP_009759289.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana sylvestris] XP_009759290.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana sylvestris] XP_016512007.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana tabacum] XP_016512008.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana tabacum] XP_016512009.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana tabacum] XP_019245823.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana attenuata] XP_019245824.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana attenuata] XP_019245825.1 PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana attenuata] OIT03507.1 udp-glucuronic acid decarboxylase 6 [Nicotiana attenuata] Length = 343 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPKIKLRDG+PLMEEDFR RLGI R Sbjct: 307 ITKAKELLGWEPKIKLRDGIPLMEEDFRGRLGISR 341 >XP_011469795.1 PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Fragaria vesca subsp. vesca] XP_011469796.1 PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Fragaria vesca subsp. vesca] Length = 341 Score = 68.6 bits (166), Expect = 3e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQRN 186 I+KAKELLGWEPK+KLRDGLPLME+DFR RLG+ RN Sbjct: 306 ISKAKELLGWEPKVKLRDGLPLMEDDFRTRLGVPRN 341 >AAB68605.1 thymidine diphospho-glucose 4-6-dehydratase homolog, partial [Prunus armeniaca] Length = 265 Score = 67.8 bits (164), Expect = 3e-11 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQRN 186 ITKAK+LLGWEPK+KLRDGLPLME+DFR RLG+ +N Sbjct: 229 ITKAKDLLGWEPKVKLRDGLPLMEDDFRTRLGVPKN 264 >KJB55911.1 hypothetical protein B456_009G100900 [Gossypium raimondii] Length = 313 Score = 68.2 bits (165), Expect = 4e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 293 ITKAKELLGWEPKIKLRDGLPLMEEDFRKRLGIQR 189 ITKAKELLGWEPK+KLRDGLPLMEEDFR RLGI + Sbjct: 278 ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGISK 312