BLASTX nr result
ID: Panax24_contig00029864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029864 (350 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011089962.1 PREDICTED: DNA ligase 1-like [Sesamum indicum] 58 2e-07 >XP_011089962.1 PREDICTED: DNA ligase 1-like [Sesamum indicum] Length = 841 Score = 57.8 bits (138), Expect = 2e-07 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = -2 Query: 349 EQTLLAALGHAAHYTEKHSSPPARIDFPLEEVTLCILLHYDDPIPNRLPIYNIYSSAL 176 EQTLLAALGHAA Y+EKHSSPPA++D PLEE + Y + +P+Y+ AL Sbjct: 395 EQTLLAALGHAAVYSEKHSSPPAKVDNPLEEAAKIVKQVY-----SVIPVYDKIVPAL 447