BLASTX nr result
ID: Panax24_contig00029672
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029672 (653 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO85147.1 hypothetical protein CCACVL1_10387 [Corchorus capsula... 85 1e-15 XP_006480961.1 PREDICTED: UPF0503 protein At3g09070, chloroplast... 85 1e-15 OMO97493.1 hypothetical protein COLO4_14595 [Corchorus olitorius] 85 1e-15 KDO53224.1 hypothetical protein CISIN_1g005928mg [Citrus sinensis] 84 3e-15 XP_006429302.1 hypothetical protein CICLE_v10011239mg [Citrus cl... 84 3e-15 XP_002273894.1 PREDICTED: UPF0503 protein At3g09070, chloroplast... 84 5e-15 XP_017977583.1 PREDICTED: UPF0503 protein At3g09070, chloroplast... 84 5e-15 EOY07292.1 Uncharacterized protein TCM_021761 [Theobroma cacao] 84 5e-15 GAV91769.1 DUF740 domain-containing protein [Cephalotus follicul... 84 5e-15 GAV68534.1 DUF740 domain-containing protein, partial [Cephalotus... 84 5e-15 XP_002534570.1 PREDICTED: UPF0503 protein At3g09070, chloroplast... 83 6e-15 KZM83750.1 hypothetical protein DCAR_028828 [Daucus carota subsp... 81 2e-14 OAY41444.1 hypothetical protein MANES_09G102200 [Manihot esculenta] 82 2e-14 XP_011077591.1 PREDICTED: UPF0503 protein At3g09070, chloroplast... 82 2e-14 XP_012087910.1 PREDICTED: UPF0503 protein At3g09070, chloroplast... 82 2e-14 XP_017223417.1 PREDICTED: UPF0503 protein At3g09070, chloroplast... 81 3e-14 XP_002322958.1 hypothetical protein POPTR_0016s11900g [Populus t... 79 2e-13 XP_011003641.1 PREDICTED: UPF0503 protein At3g09070, chloroplast... 79 2e-13 XP_002308207.2 glycine-rich family protein [Populus trichocarpa]... 78 3e-13 OAY43666.1 hypothetical protein MANES_08G087800 [Manihot esculenta] 77 6e-13 >OMO85147.1 hypothetical protein CCACVL1_10387 [Corchorus capsularis] Length = 658 Score = 85.1 bits (209), Expect = 1e-15 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNI+NGLLRFYLTP+RG+RRGG GKSK+S++HSIARSVLRLY Sbjct: 613 RYSPNNIDNGLLRFYLTPMRGSRRGGSGKSKASHAHSIARSVLRLY 658 >XP_006480961.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic [Citrus sinensis] XP_015386771.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic [Citrus sinensis] Length = 669 Score = 85.1 bits (209), Expect = 1e-15 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNIENGLLRFYLTP+RG+RRGG GK++SS++HSIARSVLRLY Sbjct: 624 RYSPNNIENGLLRFYLTPMRGSRRGGSGKTRSSHAHSIARSVLRLY 669 >OMO97493.1 hypothetical protein COLO4_14595 [Corchorus olitorius] Length = 681 Score = 85.1 bits (209), Expect = 1e-15 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNI+NGLLRFYLTP+RG+RRGG GKSK+S++HSIARSVLRLY Sbjct: 636 RYSPNNIDNGLLRFYLTPMRGSRRGGSGKSKASHAHSIARSVLRLY 681 >KDO53224.1 hypothetical protein CISIN_1g005928mg [Citrus sinensis] Length = 669 Score = 84.0 bits (206), Expect = 3e-15 Identities = 38/46 (82%), Positives = 45/46 (97%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNIENGLLRFYLTP+RG+RRGG GK++S+++HSIARSVLRLY Sbjct: 624 RYSPNNIENGLLRFYLTPMRGSRRGGSGKTRSNHAHSIARSVLRLY 669 >XP_006429302.1 hypothetical protein CICLE_v10011239mg [Citrus clementina] ESR42542.1 hypothetical protein CICLE_v10011239mg [Citrus clementina] Length = 670 Score = 84.0 bits (206), Expect = 3e-15 Identities = 38/46 (82%), Positives = 45/46 (97%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNIENGLLRFYLTP+RG+RRGG GK++S+++HSIARSVLRLY Sbjct: 625 RYSPNNIENGLLRFYLTPMRGSRRGGSGKTRSNHAHSIARSVLRLY 670 >XP_002273894.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Vitis vinifera] XP_010654197.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Vitis vinifera] Length = 663 Score = 83.6 bits (205), Expect = 5e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNI+NGLLRFYLTPLR +RRGG GK++ SNSHSIARSVLRLY Sbjct: 618 RYSPNNIDNGLLRFYLTPLRSSRRGGSGKTRPSNSHSIARSVLRLY 663 >XP_017977583.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic [Theobroma cacao] Length = 669 Score = 83.6 bits (205), Expect = 5e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNIENGLLRFYLTPLR +RRGG GKS++S++HSIARSVLRLY Sbjct: 624 RYSPNNIENGLLRFYLTPLRSSRRGGSGKSRASHAHSIARSVLRLY 669 >EOY07292.1 Uncharacterized protein TCM_021761 [Theobroma cacao] Length = 675 Score = 83.6 bits (205), Expect = 5e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNIENGLLRFYLTPLR +RRGG GKS++S++HSIARSVLRLY Sbjct: 630 RYSPNNIENGLLRFYLTPLRSSRRGGSGKSRASHAHSIARSVLRLY 675 >GAV91769.1 DUF740 domain-containing protein [Cephalotus follicularis] Length = 679 Score = 83.6 bits (205), Expect = 5e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNIENGLLRFYLTP+R + RGGLGKSKS+++HSIARSVLRLY Sbjct: 634 RYSPNNIENGLLRFYLTPMRSSGRGGLGKSKSTHAHSIARSVLRLY 679 >GAV68534.1 DUF740 domain-containing protein, partial [Cephalotus follicularis] Length = 686 Score = 83.6 bits (205), Expect = 5e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNIENGLLRFYLTP+R + RGGLGKSKS+++HSIARSVLRLY Sbjct: 641 RYSPNNIENGLLRFYLTPMRSSGRGGLGKSKSTHAHSIARSVLRLY 686 >XP_002534570.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic [Ricinus communis] EEF27813.1 conserved hypothetical protein [Ricinus communis] Length = 676 Score = 83.2 bits (204), Expect = 6e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNI+NGLLRFYLTP+RG+RRGG GKSKSS++ SIARSVLRLY Sbjct: 631 RYSPNNIDNGLLRFYLTPMRGSRRGGWGKSKSSHAQSIARSVLRLY 676 >KZM83750.1 hypothetical protein DCAR_028828 [Daucus carota subsp. sativus] Length = 403 Score = 81.3 bits (199), Expect = 2e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYS ++I+NGLLRFYLTPLRG+RRGGLGKS+SSNS SIARSVLRLY Sbjct: 358 RYSTSDIDNGLLRFYLTPLRGSRRGGLGKSRSSNSQSIARSVLRLY 403 >OAY41444.1 hypothetical protein MANES_09G102200 [Manihot esculenta] Length = 654 Score = 81.6 bits (200), Expect = 2e-14 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNI+NGLLRFYLTPLR +RRGG GKSKSS++ SIARSVLRLY Sbjct: 609 RYSPNNIDNGLLRFYLTPLRSSRRGGWGKSKSSHAQSIARSVLRLY 654 >XP_011077591.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Sesamum indicum] Length = 674 Score = 81.6 bits (200), Expect = 2e-14 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPN+++NGLLRFYLTP+R +RRGGLGK K +NSHSIARSVLRLY Sbjct: 629 RYSPNHVDNGLLRFYLTPMRSSRRGGLGKIKPNNSHSIARSVLRLY 674 >XP_012087910.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic [Jatropha curcas] KDP24489.1 hypothetical protein JCGZ_25053 [Jatropha curcas] Length = 680 Score = 81.6 bits (200), Expect = 2e-14 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNI+NGLLRFYLTPLR +RRGG GKSKSS++ SIARSVLRLY Sbjct: 635 RYSPNNIDNGLLRFYLTPLRSSRRGGWGKSKSSHAQSIARSVLRLY 680 >XP_017223417.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic-like, partial [Daucus carota subsp. sativus] Length = 693 Score = 81.3 bits (199), Expect = 3e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYS ++I+NGLLRFYLTPLRG+RRGGLGKS+SSNS SIARSVLRLY Sbjct: 648 RYSTSDIDNGLLRFYLTPLRGSRRGGLGKSRSSNSQSIARSVLRLY 693 >XP_002322958.1 hypothetical protein POPTR_0016s11900g [Populus trichocarpa] EEF04719.1 hypothetical protein POPTR_0016s11900g [Populus trichocarpa] Length = 628 Score = 79.0 bits (193), Expect = 2e-13 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNN+ENGLLRFYLTPLR +RR G GKSKSS + SIARSVLRLY Sbjct: 583 RYSPNNMENGLLRFYLTPLRNSRRNGWGKSKSSQAQSIARSVLRLY 628 >XP_011003641.1 PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Populus euphratica] Length = 691 Score = 79.0 bits (193), Expect = 2e-13 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNN+ENGLLRFYLTPLR +RR G GKSKSS + SIARSVLRLY Sbjct: 646 RYSPNNMENGLLRFYLTPLRNSRRNGWGKSKSSQAQSIARSVLRLY 691 >XP_002308207.2 glycine-rich family protein [Populus trichocarpa] EEE91730.2 glycine-rich family protein [Populus trichocarpa] Length = 683 Score = 78.2 bits (191), Expect = 3e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNN++NGLLRFYLTPLR +RR G GKSKSS++ SIARSVLRLY Sbjct: 638 RYSPNNMDNGLLRFYLTPLRNSRRNGWGKSKSSHAQSIARSVLRLY 683 >OAY43666.1 hypothetical protein MANES_08G087800 [Manihot esculenta] Length = 670 Score = 77.4 bits (189), Expect = 6e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +1 Query: 1 RYSPNNIENGLLRFYLTPLRGNRRGGLGKSKSSNSHSIARSVLRLY 138 RYSPNNI+NGLLRFYLTP+R +RR G GKSKSS++ SIARSVLRLY Sbjct: 625 RYSPNNIDNGLLRFYLTPMRSSRRVGWGKSKSSHAQSIARSVLRLY 670