BLASTX nr result
ID: Panax24_contig00029664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029664 (356 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019194963.1 PREDICTED: snRNA-activating protein complex subun... 55 1e-06 KZV27587.1 SnRNA activating complex family protein isoform 4 [Do... 54 7e-06 XP_012841923.1 PREDICTED: snRNA-activating protein complex subun... 53 1e-05 >XP_019194963.1 PREDICTED: snRNA-activating protein complex subunit isoform X1 [Ipomoea nil] Length = 472 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +1 Query: 214 MPPESRAADDGGVDQNVSVPRGGPIYVPDMVVSLTKVFDFELSLVRE 354 M S D GG D N S+PRGGPIYVPDMV +LT++ DFE S+ E Sbjct: 1 MATASMDFDVGGDDPNASIPRGGPIYVPDMVSALTRIPDFESSVFHE 47 >KZV27587.1 SnRNA activating complex family protein isoform 4 [Dorcoceras hygrometricum] Length = 483 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = +1 Query: 238 DDGGVDQNVSVPRGGPIYVPDMVVSLTKVFDFELSLVRE 354 DDGG D NVS+PRGGPIYVP+M+ +T + F+ S+V E Sbjct: 6 DDGGEDLNVSIPRGGPIYVPNMISPITNIPGFQASVVSE 44 >XP_012841923.1 PREDICTED: snRNA-activating protein complex subunit [Erythranthe guttata] XP_012841924.1 PREDICTED: snRNA-activating protein complex subunit [Erythranthe guttata] Length = 475 Score = 53.1 bits (126), Expect = 1e-05 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +1 Query: 214 MPPESRAADDGGVDQNVSVPRGGPIYVPDMVVSLTKVFDFELSLVRE 354 MP +DGG + NVS+P GGPIYVPD V LT+V DFE S+ +E Sbjct: 1 MPTMLPGHEDGGEELNVSIPLGGPIYVPDSVGPLTRVPDFETSVFQE 47