BLASTX nr result
ID: Panax24_contig00029648
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029648 (782 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN10732.1 hypothetical protein DCAR_003388 [Daucus carota subsp... 45 5e-07 >KZN10732.1 hypothetical protein DCAR_003388 [Daucus carota subsp. sativus] Length = 165 Score = 44.7 bits (104), Expect(2) = 5e-07 Identities = 24/48 (50%), Positives = 30/48 (62%) Frame = -2 Query: 331 MTKNMSPDVAVEHVSADLLSLAGLLCIEDENCKPQSVHVSNPPLRNNA 188 M K S DVA E VS D LS AGL+CIE+ + + VH S P +N+A Sbjct: 1 MPKTKSKDVAAETVSTDSLSFAGLICIEERSYESPKVHAS--PAKNSA 46 Score = 37.7 bits (86), Expect(2) = 5e-07 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = -1 Query: 134 EFASATPGSTPDALNNNTLADVLFITGQLLPQMTPSET 21 EF S S +A NN +LADVLF G L+PQ S+T Sbjct: 55 EFNSVIDKSVENASNNKSLADVLFSNGHLVPQANQSQT 92