BLASTX nr result
ID: Panax24_contig00029589
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029589 (623 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAO96707.1 hypothetical protein AXX17_AT4G16140 [Arabidopsis tha... 57 6e-06 NP_567421.1 F-box/RNI-like superfamily protein [Arabidopsis thal... 57 6e-06 CAB10188.1 hypothetical protein [Arabidopsis thaliana] CAB78451.... 57 7e-06 >OAO96707.1 hypothetical protein AXX17_AT4G16140 [Arabidopsis thaliana] Length = 468 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/58 (43%), Positives = 39/58 (67%) Frame = +2 Query: 335 ESLCLPHKSLKALTTSLDVFPMFSNLTHLTLGLSKDLGWKFLPNLLTQMPKLKTLVIE 508 ++L L +L+ LT S D P+F+NLTHLT+ + ++GW+ LP LL P L+TL+ + Sbjct: 291 KTLYLSSNTLQVLTYSCDAIPIFNNLTHLTIESNPEVGWQSLPGLLKNSPNLETLIFQ 348 >NP_567421.1 F-box/RNI-like superfamily protein [Arabidopsis thaliana] NP_001319929.1 F-box/RNI-like superfamily protein [Arabidopsis thaliana] Q94B46.1 RecName: Full=F-box/LRR-repeat protein At4g14096 AAK68800.1 Unknown protein [Arabidopsis thaliana] AAM91134.1 unknown protein [Arabidopsis thaliana] AEE83371.1 F-box/RNI-like superfamily protein [Arabidopsis thaliana] ANM67110.1 F-box/RNI-like superfamily protein [Arabidopsis thaliana] Length = 468 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/58 (43%), Positives = 39/58 (67%) Frame = +2 Query: 335 ESLCLPHKSLKALTTSLDVFPMFSNLTHLTLGLSKDLGWKFLPNLLTQMPKLKTLVIE 508 ++L L +L+ LT S D P+F+NLTHLT+ + ++GW+ LP LL P L+TL+ + Sbjct: 291 KTLYLSSNTLQVLTYSCDAIPIFNNLTHLTIESNPEVGWQSLPGLLKNSPNLETLIFQ 348 >CAB10188.1 hypothetical protein [Arabidopsis thaliana] CAB78451.1 hypothetical protein [Arabidopsis thaliana] Length = 1047 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/58 (43%), Positives = 39/58 (67%) Frame = +2 Query: 335 ESLCLPHKSLKALTTSLDVFPMFSNLTHLTLGLSKDLGWKFLPNLLTQMPKLKTLVIE 508 ++L L +L+ LT S D P+F+NLTHLT+ + ++GW+ LP LL P L+TL+ + Sbjct: 529 KTLYLSSNTLQVLTYSCDAIPIFNNLTHLTIESNPEVGWQSLPGLLKNSPNLETLIFQ 586 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/64 (40%), Positives = 42/64 (65%) Frame = +2 Query: 335 ESLCLPHKSLKALTTSLDVFPMFSNLTHLTLGLSKDLGWKFLPNLLTQMPKLKTLVIEVS 514 ++L L +L+ LT S D P+F+NLTHLT+ + +GW+ +P LL P L+TL+ +V Sbjct: 949 KTLYLSANTLQVLTYSCDAIPIFNNLTHLTIESNPRVGWQSVPGLLKNSPNLETLIFQVR 1008 Query: 515 SEGL 526 ++ L Sbjct: 1009 NKPL 1012