BLASTX nr result
ID: Panax24_contig00029526
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029526 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016572781.1 PREDICTED: uncharacterized protein LOC107870691 [... 56 7e-07 XP_010656676.1 PREDICTED: uncharacterized protein LOC100256672 [... 53 7e-06 >XP_016572781.1 PREDICTED: uncharacterized protein LOC107870691 [Capsicum annuum] Length = 238 Score = 55.8 bits (133), Expect = 7e-07 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 362 GGTSSSDGVHQWQQHCMVLQLPQNASPPIVWFR 264 G + ++G+H WQQHCM QLPQN SPPI W+R Sbjct: 206 GAVNVNEGLHHWQQHCMTTQLPQNTSPPIAWYR 238 >XP_010656676.1 PREDICTED: uncharacterized protein LOC100256672 [Vitis vinifera] CAN60849.1 hypothetical protein VITISV_023571 [Vitis vinifera] CBI40666.3 unnamed protein product, partial [Vitis vinifera] Length = 234 Score = 53.1 bits (126), Expect = 7e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -1 Query: 365 FGGTSSSDGVHQWQQ-HCMVLQLPQNASPPIVWFR 264 FGG S+ +HQWQQ HCM QLPQN S PI WFR Sbjct: 200 FGGMRGSESLHQWQQQHCMTPQLPQNMSTPITWFR 234