BLASTX nr result
ID: Panax24_contig00029458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029458 (502 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP04994.1 unnamed protein product [Coffea canephora] 57 1e-07 KCW89084.1 hypothetical protein EUGRSUZ_A01413, partial [Eucalyp... 55 4e-06 >CDP04994.1 unnamed protein product [Coffea canephora] Length = 99 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = -1 Query: 163 MSFGIIHRDVNGDWEKSGWSCGYFINNWRFLLTLRRSIHLQNFREDGETNF 11 MSFGIIHRDV+ +WE+SGW+C Y + +NFRED ETNF Sbjct: 1 MSFGIIHRDVDWEWEESGWTCVYLYKIGGSCSISEELYNCKNFREDEETNF 51 >KCW89084.1 hypothetical protein EUGRSUZ_A01413, partial [Eucalyptus grandis] Length = 232 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -1 Query: 187 YMPSAWTSMSFGIIHRDVNGDWEKSGWSCGYFINNWRFLLTLRRSIHL-QNFREDGETNF 11 +M SAWT+MSF +I RD+ +WE G G F+NNWR +L +++ +N ED E F Sbjct: 130 WMTSAWTNMSFAVIRRDLEREWENQGGVMGIFLNNWR-PWSLPEDLYICENSGEDVEIKF 188 Query: 10 YFK 2 F+ Sbjct: 189 VFE 191