BLASTX nr result
ID: Panax24_contig00029163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029163 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017223205.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 68 4e-11 OAY84043.1 26S proteasome non-ATPase regulatory subunit 10 [Anan... 66 1e-10 XP_020095285.1 26S proteasome non-ATPase regulatory subunit 10 [... 66 1e-10 OMP09119.1 hypothetical protein COLO4_05797 [Corchorus olitorius] 65 3e-10 OMO61397.1 hypothetical protein CCACVL1_23546 [Corchorus capsula... 65 3e-10 XP_006438794.1 hypothetical protein CICLE_v10032613mg [Citrus cl... 65 3e-10 XP_002315012.1 ankyrin repeat family protein [Populus trichocarp... 65 4e-10 XP_010066858.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 65 4e-10 XP_010096570.1 26S proteasome non-ATPase regulatory subunit 10 [... 65 5e-10 XP_004297261.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 65 6e-10 XP_012067741.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 65 6e-10 XP_018836212.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 65 6e-10 XP_010258189.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 65 6e-10 KCW64899.1 hypothetical protein EUGRSUZ_G02461 [Eucalyptus grandis] 65 8e-10 KHN02012.1 26S proteasome non-ATPase regulatory subunit 10 [Glyc... 63 8e-10 XP_006348714.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 64 8e-10 CAN63831.1 hypothetical protein VITISV_009129 [Vitis vinifera] 63 1e-09 XP_015074925.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 64 1e-09 XP_004239075.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 64 1e-09 XP_015894970.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 64 2e-09 >XP_017223205.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Daucus carota subsp. sativus] KZM85126.1 hypothetical protein DCAR_027452 [Daucus carota subsp. sativus] Length = 240 Score = 67.8 bits (164), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS+DLRPLLIDAAKAMLEG Sbjct: 207 DVDVEDKEGYTVLGRASNDLRPLLIDAAKAMLEG 240 >OAY84043.1 26S proteasome non-ATPase regulatory subunit 10 [Ananas comosus] Length = 228 Score = 66.2 bits (160), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVD+EDKEGYTVLGRASHD RP LIDAAKAMLEG Sbjct: 195 DVDIEDKEGYTVLGRASHDFRPSLIDAAKAMLEG 228 >XP_020095285.1 26S proteasome non-ATPase regulatory subunit 10 [Ananas comosus] Length = 237 Score = 66.2 bits (160), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVD+EDKEGYTVLGRASHD RP LIDAAKAMLEG Sbjct: 204 DVDIEDKEGYTVLGRASHDFRPSLIDAAKAMLEG 237 >OMP09119.1 hypothetical protein COLO4_05797 [Corchorus olitorius] Length = 234 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVD+EDKEGYTVLGRAS+D RPLL+DAAKAMLEG Sbjct: 201 DVDIEDKEGYTVLGRASNDFRPLLVDAAKAMLEG 234 >OMO61397.1 hypothetical protein CCACVL1_23546 [Corchorus capsularis] Length = 234 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVD+EDKEGYTVLGRAS+D RPLL+DAAKAMLEG Sbjct: 201 DVDIEDKEGYTVLGRASNDFRPLLVDAAKAMLEG 234 >XP_006438794.1 hypothetical protein CICLE_v10032613mg [Citrus clementina] XP_006438796.1 hypothetical protein CICLE_v10032613mg [Citrus clementina] XP_015387322.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 isoform X1 [Citrus sinensis] ESR52034.1 hypothetical protein CICLE_v10032613mg [Citrus clementina] ESR52036.1 hypothetical protein CICLE_v10032613mg [Citrus clementina] KDO83086.1 hypothetical protein CISIN_1g026440mg [Citrus sinensis] Length = 238 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS+D RP+LIDAAKAMLEG Sbjct: 205 DVDVEDKEGYTVLGRASNDFRPILIDAAKAMLEG 238 >XP_002315012.1 ankyrin repeat family protein [Populus trichocarpa] EEF01183.1 ankyrin repeat family protein [Populus trichocarpa] Length = 244 Score = 65.1 bits (157), Expect = 4e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS D RP+LIDAAKAMLEG Sbjct: 211 DVDVEDKEGYTVLGRASEDFRPILIDAAKAMLEG 244 >XP_010066858.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Eucalyptus grandis] Length = 247 Score = 65.1 bits (157), Expect = 4e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRASHD RP L+DAAKAMLEG Sbjct: 214 DVDVEDKEGYTVLGRASHDWRPALMDAAKAMLEG 247 >XP_010096570.1 26S proteasome non-ATPase regulatory subunit 10 [Morus notabilis] EXB65070.1 26S proteasome non-ATPase regulatory subunit 10 [Morus notabilis] Length = 255 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS+D RP+L+DAAKAMLEG Sbjct: 222 DVDVEDKEGYTVLGRASNDFRPILVDAAKAMLEG 255 >XP_004297261.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Fragaria vesca subsp. vesca] Length = 239 Score = 64.7 bits (156), Expect = 6e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS++ RPLLIDAAKAMLEG Sbjct: 206 DVDVEDKEGYTVLGRASNEFRPLLIDAAKAMLEG 239 >XP_012067741.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Jatropha curcas] XP_012067742.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Jatropha curcas] XP_012067743.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Jatropha curcas] KDP41272.1 hypothetical protein JCGZ_15679 [Jatropha curcas] Length = 242 Score = 64.7 bits (156), Expect = 6e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS D RP+LIDAAKAMLEG Sbjct: 209 DVDVEDKEGYTVLGRASDDFRPMLIDAAKAMLEG 242 >XP_018836212.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Juglans regia] Length = 243 Score = 64.7 bits (156), Expect = 6e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS D RP+LIDAAKAMLEG Sbjct: 210 DVDVEDKEGYTVLGRASDDFRPILIDAAKAMLEG 243 >XP_010258189.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 isoform X1 [Nelumbo nucifera] Length = 244 Score = 64.7 bits (156), Expect = 6e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS D RPLLIDAAKAMLEG Sbjct: 211 DVDVEDKEGYTVLGRASVDFRPLLIDAAKAMLEG 244 >KCW64899.1 hypothetical protein EUGRSUZ_G02461 [Eucalyptus grandis] Length = 324 Score = 65.1 bits (157), Expect = 8e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRASHD RP L+DAAKAMLEG Sbjct: 291 DVDVEDKEGYTVLGRASHDWRPALMDAAKAMLEG 324 >KHN02012.1 26S proteasome non-ATPase regulatory subunit 10 [Glycine soja] Length = 169 Score = 63.2 bits (152), Expect = 8e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLE 299 DVDVEDKEGYTVLGRA+H+ RP+LIDAAKAMLE Sbjct: 137 DVDVEDKEGYTVLGRATHEFRPILIDAAKAMLE 169 >XP_006348714.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Solanum tuberosum] Length = 239 Score = 64.3 bits (155), Expect = 8e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRAS+DLRP+L+DAAK MLEG Sbjct: 206 DVDVEDKEGYTVLGRASNDLRPVLVDAAKMMLEG 239 >CAN63831.1 hypothetical protein VITISV_009129 [Vitis vinifera] Length = 168 Score = 62.8 bits (151), Expect = 1e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGR S D RP+L+DAAKAMLEG Sbjct: 135 DVDVEDKEGYTVLGRTSDDFRPILVDAAKAMLEG 168 >XP_015074925.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Solanum pennellii] Length = 239 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVD+EDKEGYTVLGRAS+DLRP+L+DAAK MLEG Sbjct: 206 DVDIEDKEGYTVLGRASNDLRPVLVDAAKMMLEG 239 >XP_004239075.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Solanum lycopersicum] Length = 239 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVD+EDKEGYTVLGRAS+DLRP+L+DAAK MLEG Sbjct: 206 DVDIEDKEGYTVLGRASNDLRPVLVDAAKMMLEG 239 >XP_015894970.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 10 [Ziziphus jujuba] Length = 244 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 397 DVDVEDKEGYTVLGRASHDLRPLLIDAAKAMLEG 296 DVDVEDKEGYTVLGRA+ D RP+LIDAAKAMLEG Sbjct: 211 DVDVEDKEGYTVLGRAADDFRPILIDAAKAMLEG 244