BLASTX nr result
ID: Panax24_contig00029053
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00029053 (764 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255151.1 PREDICTED: putative aminoacrylate hydrolase RutD ... 57 8e-06 >XP_017255151.1 PREDICTED: putative aminoacrylate hydrolase RutD [Daucus carota subsp. sativus] KZM92300.1 hypothetical protein DCAR_020335 [Daucus carota subsp. sativus] Length = 401 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 VNEALLELIRASESEIDPLEWTNLPQPSPG 92 VN+ALLELIRASES++DPLEWTN+PQPS G Sbjct: 308 VNQALLELIRASESDMDPLEWTNIPQPSAG 337