BLASTX nr result
ID: Panax24_contig00028949
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028949 (455 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY56422.1 hypothetical protein MANES_02G015100 [Manihot esculenta] 69 8e-11 XP_019151661.1 PREDICTED: calcium-dependent protein kinase 1-lik... 68 2e-10 XP_017235000.1 PREDICTED: calcium-dependent protein kinase 3-lik... 68 2e-10 XP_018829273.1 PREDICTED: calcium-dependent protein kinase 1-lik... 68 2e-10 KHN25667.1 Calcium-dependent protein kinase 3 [Glycine soja] 67 2e-10 XP_018837191.1 PREDICTED: calcium-dependent protein kinase 1-lik... 67 3e-10 KRH77599.1 hypothetical protein GLYMA_01G223200 [Glycine max] 67 3e-10 XP_003517491.3 PREDICTED: calcium-dependent protein kinase 3-lik... 67 3e-10 XP_007158545.1 hypothetical protein PHAVU_002G161200g [Phaseolus... 67 4e-10 XP_010251583.1 PREDICTED: calcium-dependent protein kinase 1-lik... 67 4e-10 XP_002509886.1 PREDICTED: calcium-dependent protein kinase 3 [Ri... 67 4e-10 XP_015896537.1 PREDICTED: calcium-dependent protein kinase 3 [Zi... 67 4e-10 XP_009334485.1 PREDICTED: calcium-dependent protein kinase 3 [Py... 67 5e-10 XP_012086799.1 PREDICTED: calcium-dependent protein kinase 3 [Ja... 67 5e-10 XP_008451994.1 PREDICTED: calcium-dependent protein kinase 3 [Cu... 67 5e-10 XP_004511540.1 PREDICTED: calcium-dependent protein kinase 3-lik... 66 7e-10 XP_010261434.1 PREDICTED: calcium-dependent protein kinase 1-lik... 66 7e-10 ANO46334.1 calcium-dependent protein kinase 3 [Camellia sinensis] 66 1e-09 KHN35055.1 Calcium-dependent protein kinase 3 [Glycine soja] 65 1e-09 XP_003538256.1 PREDICTED: calcium-dependent protein kinase 3 [Gl... 65 1e-09 >OAY56422.1 hypothetical protein MANES_02G015100 [Manihot esculenta] Length = 459 Score = 68.9 bits (167), Expect = 8e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTDNDGRINY+EFVAMMRKG+PELVTN Sbjct: 422 KEIIAEVDTDNDGRINYEEFVAMMRKGNPELVTN 455 >XP_019151661.1 PREDICTED: calcium-dependent protein kinase 1-like [Ipomoea nil] Length = 514 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTDNDG+INYDEFVAMMRKG+P+LVTN Sbjct: 477 KEIIAEVDTDNDGKINYDEFVAMMRKGTPDLVTN 510 >XP_017235000.1 PREDICTED: calcium-dependent protein kinase 3-like [Daucus carota subsp. sativus] KZN06014.1 hypothetical protein DCAR_006851 [Daucus carota subsp. sativus] Length = 521 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTDNDGRINYDEFV MMRKG+PELVTN Sbjct: 484 KEIIAEVDTDNDGRINYDEFVDMMRKGNPELVTN 517 >XP_018829273.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] Length = 515 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTDNDGRINYDEFV MMRKG+P+LVTN Sbjct: 478 KEIIAEVDTDNDGRINYDEFVTMMRKGNPDLVTN 511 >KHN25667.1 Calcium-dependent protein kinase 3 [Glycine soja] Length = 383 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEII EVDTDNDGRINYDEFVAMMRKG P+LVTN Sbjct: 346 KEIIVEVDTDNDGRINYDEFVAMMRKGKPDLVTN 379 >XP_018837191.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] XP_018837192.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] Length = 521 Score = 67.4 bits (163), Expect = 3e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTDNDGRINYDEFV MMRKG+P+L+TN Sbjct: 484 KEIIAEVDTDNDGRINYDEFVTMMRKGNPDLITN 517 >KRH77599.1 hypothetical protein GLYMA_01G223200 [Glycine max] Length = 528 Score = 67.4 bits (163), Expect = 3e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEII EVDTDNDGRINYDEFVAMMRKG P+LVTN Sbjct: 491 KEIIVEVDTDNDGRINYDEFVAMMRKGKPDLVTN 524 >XP_003517491.3 PREDICTED: calcium-dependent protein kinase 3-like [Glycine max] Length = 542 Score = 67.4 bits (163), Expect = 3e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEII EVDTDNDGRINYDEFVAMMRKG P+LVTN Sbjct: 505 KEIIVEVDTDNDGRINYDEFVAMMRKGKPDLVTN 538 >XP_007158545.1 hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris] ESW30539.1 hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris] Length = 502 Score = 67.0 bits (162), Expect = 4e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVT 99 KEIIAEVDTDNDGRINYDEFVAMMRKG+P+LVT Sbjct: 466 KEIIAEVDTDNDGRINYDEFVAMMRKGNPDLVT 498 >XP_010251583.1 PREDICTED: calcium-dependent protein kinase 1-like [Nelumbo nucifera] Length = 522 Score = 67.0 bits (162), Expect = 4e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTD+DGRINYDEFVAMMRKG+PEL TN Sbjct: 485 KEIIAEVDTDHDGRINYDEFVAMMRKGNPELTTN 518 >XP_002509886.1 PREDICTED: calcium-dependent protein kinase 3 [Ricinus communis] EEF51273.1 calcium-dependent protein kinase, putative [Ricinus communis] Length = 528 Score = 67.0 bits (162), Expect = 4e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTD+DGRINY+EFVAMMRKG+PELVTN Sbjct: 491 KEIIAEVDTDHDGRINYEEFVAMMRKGNPELVTN 524 >XP_015896537.1 PREDICTED: calcium-dependent protein kinase 3 [Ziziphus jujuba] Length = 531 Score = 67.0 bits (162), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTDNDGRINYDEFVAMMRKG+P++ TN Sbjct: 494 KEIIAEVDTDNDGRINYDEFVAMMRKGNPDMATN 527 >XP_009334485.1 PREDICTED: calcium-dependent protein kinase 3 [Pyrus x bretschneideri] Length = 525 Score = 66.6 bits (161), Expect = 5e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTD DGRINYDEF AMMRKG+PELVTN Sbjct: 488 KEIIAEVDTDRDGRINYDEFAAMMRKGNPELVTN 521 >XP_012086799.1 PREDICTED: calcium-dependent protein kinase 3 [Jatropha curcas] KDP25359.1 hypothetical protein JCGZ_20515 [Jatropha curcas] Length = 525 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTDNDG+INY+EFVAMMRKG+P+LVTN Sbjct: 488 KEIIAEVDTDNDGKINYEEFVAMMRKGNPDLVTN 521 >XP_008451994.1 PREDICTED: calcium-dependent protein kinase 3 [Cucumis melo] Length = 527 Score = 66.6 bits (161), Expect = 5e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVT 99 KEIIAEVDTDNDGRINYDEFVAMMRKG+PEL T Sbjct: 490 KEIIAEVDTDNDGRINYDEFVAMMRKGNPELTT 522 >XP_004511540.1 PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum] Length = 509 Score = 66.2 bits (160), Expect = 7e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVD+DNDGRINY+EFVAMMRKG+P+LVTN Sbjct: 472 KEIIAEVDSDNDGRINYEEFVAMMRKGNPDLVTN 505 >XP_010261434.1 PREDICTED: calcium-dependent protein kinase 1-like [Nelumbo nucifera] Length = 531 Score = 66.2 bits (160), Expect = 7e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVDTD+DG+INYDEFVAMM+KG+PELVTN Sbjct: 494 KEIIAEVDTDHDGKINYDEFVAMMKKGNPELVTN 527 >ANO46334.1 calcium-dependent protein kinase 3 [Camellia sinensis] Length = 505 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 K+II EVDTD+DGRINYDEFVAMMRKG+PELVTN Sbjct: 468 KDIITEVDTDHDGRINYDEFVAMMRKGNPELVTN 501 >KHN35055.1 Calcium-dependent protein kinase 3 [Glycine soja] Length = 373 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVD DNDGRINYDEFVAMMRKG+P+LV N Sbjct: 336 KEIIAEVDADNDGRINYDEFVAMMRKGNPDLVNN 369 >XP_003538256.1 PREDICTED: calcium-dependent protein kinase 3 [Glycine max] KRH27875.1 hypothetical protein GLYMA_11G020200 [Glycine max] Length = 505 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTN 102 KEIIAEVD DNDGRINYDEFVAMMRKG+P+LV N Sbjct: 468 KEIIAEVDADNDGRINYDEFVAMMRKGNPDLVNN 501