BLASTX nr result
ID: Panax24_contig00028874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00028874 (483 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228540.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 95 9e-20 XP_017228534.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 95 9e-20 KZN10387.1 hypothetical protein DCAR_003043 [Daucus carota subsp... 95 9e-20 XP_010648639.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 95 1e-19 XP_010648638.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 95 1e-19 XP_002285000.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 95 1e-19 KVH99795.1 Cyclophilin-like peptidyl-prolyl cis-trans isomerase ... 90 5e-18 XP_015084937.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-16 XP_010325121.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-16 XP_019070745.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-16 XP_015084936.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-16 XP_010325122.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-16 XP_015084935.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-16 XP_015084934.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-16 XP_004245196.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-16 OIS97707.1 hypothetical protein A4A49_05445 [Nicotiana attenuata] 83 2e-16 KZV52147.1 hypothetical protein F511_07102 [Dorcoceras hygrometr... 85 3e-16 XP_017184879.1 PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl c... 85 3e-16 XP_011084184.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 85 4e-16 XP_018498159.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 85 4e-16 >XP_017228540.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Daucus carota subsp. sativus] Length = 649 Score = 95.1 bits (235), Expect = 9e-20 Identities = 48/56 (85%), Positives = 49/56 (87%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 N+RRS SRSPVG GRRARSPYA R RSISRSPSPDGS KRIRRGRGFS RYS ARR Sbjct: 452 NSRRSYSRSPVGYGRRARSPYADRARSISRSPSPDGSTKRIRRGRGFSQRYSTARR 507 >XP_017228534.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Daucus carota subsp. sativus] Length = 758 Score = 95.1 bits (235), Expect = 9e-20 Identities = 48/56 (85%), Positives = 49/56 (87%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 N+RRS SRSPVG GRRARSPYA R RSISRSPSPDGS KRIRRGRGFS RYS ARR Sbjct: 561 NSRRSYSRSPVGYGRRARSPYADRARSISRSPSPDGSTKRIRRGRGFSQRYSTARR 616 >KZN10387.1 hypothetical protein DCAR_003043 [Daucus carota subsp. sativus] Length = 766 Score = 95.1 bits (235), Expect = 9e-20 Identities = 48/56 (85%), Positives = 49/56 (87%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 N+RRS SRSPVG GRRARSPYA R RSISRSPSPDGS KRIRRGRGFS RYS ARR Sbjct: 569 NSRRSYSRSPVGYGRRARSPYADRARSISRSPSPDGSTKRIRRGRGFSQRYSTARR 624 >XP_010648639.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Vitis vinifera] Length = 686 Score = 94.7 bits (234), Expect = 1e-19 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSP +GRRARSP + R R++SRSPSPDGSPKRIRRGRGFS RYSYARR Sbjct: 478 NNRRSYSRSPASSGRRARSPASDRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARR 533 >XP_010648638.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Vitis vinifera] Length = 795 Score = 94.7 bits (234), Expect = 1e-19 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSP +GRRARSP + R R++SRSPSPDGSPKRIRRGRGFS RYSYARR Sbjct: 587 NNRRSYSRSPASSGRRARSPASDRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARR 642 >XP_002285000.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Vitis vinifera] XP_010648637.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Vitis vinifera] Length = 796 Score = 94.7 bits (234), Expect = 1e-19 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSP +GRRARSP + R R++SRSPSPDGSPKRIRRGRGFS RYSYARR Sbjct: 588 NNRRSYSRSPASSGRRARSPASDRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARR 643 >KVH99795.1 Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 847 Score = 90.1 bits (222), Expect = 5e-18 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 ++RRS SRSPVG GRRARSP RGRS+SRS SPDGSPKRIRRGRGFS+RYSYARR Sbjct: 639 SSRRSYSRSPVG-GRRARSPLGDRGRSLSRSASPDGSPKRIRRGRGFSNRYSYARR 693 >XP_015084937.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Solanum pennellii] Length = 698 Score = 86.3 bits (212), Expect = 1e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP R RS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 501 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 556 >XP_010325121.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Solanum lycopersicum] XP_019070746.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Solanum lycopersicum] Length = 698 Score = 86.3 bits (212), Expect = 1e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP R RS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 501 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 556 >XP_019070745.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Solanum lycopersicum] Length = 731 Score = 86.3 bits (212), Expect = 1e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP R RS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 534 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 589 >XP_015084936.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Solanum pennellii] Length = 731 Score = 86.3 bits (212), Expect = 1e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP R RS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 534 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 589 >XP_010325122.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Solanum lycopersicum] Length = 746 Score = 86.3 bits (212), Expect = 1e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP R RS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 549 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 604 >XP_015084935.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Solanum pennellii] Length = 754 Score = 86.3 bits (212), Expect = 1e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP R RS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 557 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 612 >XP_015084934.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Solanum pennellii] Length = 807 Score = 86.3 bits (212), Expect = 1e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP R RS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 610 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 665 >XP_004245196.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Solanum lycopersicum] Length = 807 Score = 86.3 bits (212), Expect = 1e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP R RS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 610 NNRRSYSRSPVSAGRRARSPVYDRARSSSRSASVDGSPKRIRRGRGFSERYSYVRR 665 >OIS97707.1 hypothetical protein A4A49_05445 [Nicotiana attenuata] Length = 254 Score = 83.2 bits (204), Expect = 2e-16 Identities = 44/56 (78%), Positives = 44/56 (78%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSPV GRRARSP GRS SRS S DGSPKRIRRGRGFS RYSY RR Sbjct: 156 NNRRSYSRSPVSAGRRARSP----GRSSSRSASVDGSPKRIRRGRGFSERYSYVRR 207 >KZV52147.1 hypothetical protein F511_07102 [Dorcoceras hygrometricum] Length = 771 Score = 85.1 bits (209), Expect = 3e-16 Identities = 43/54 (79%), Positives = 45/54 (83%) Frame = +2 Query: 320 RRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 RRS SRSPV +GRRARSP + RG S SRSPS DGSPKRIRRGRGFS RYSY RR Sbjct: 572 RRSYSRSPVISGRRARSPVSIRGGSSSRSPSADGSPKRIRRGRGFSDRYSYVRR 625 >XP_017184879.1 PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase CYP95-like [Malus domestica] Length = 496 Score = 84.7 bits (208), Expect = 3e-16 Identities = 44/57 (77%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAY-RGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSP RR RSP + RGRS+SRS SPDGSPKRIRRGRGFS RYSYARR Sbjct: 283 NNRRSYSRSPSPVARRVRSPISPDRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARR 339 >XP_011084184.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum indicum] XP_011084254.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum indicum] XP_011084337.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum indicum] Length = 784 Score = 84.7 bits (208), Expect = 4e-16 Identities = 43/55 (78%), Positives = 44/55 (80%) Frame = +2 Query: 317 NRRSISRSPVGTGRRARSPYAYRGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NR S S SPV GRRARSP + RGRS SRSPS DGSPKRIRRGRGFS RYSY RR Sbjct: 577 NRPSYSGSPVSAGRRARSPVSDRGRSSSRSPSVDGSPKRIRRGRGFSDRYSYVRR 631 >XP_018498159.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform X3 [Pyrus x bretschneideri] Length = 833 Score = 84.7 bits (208), Expect = 4e-16 Identities = 44/57 (77%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = +2 Query: 314 NNRRSISRSPVGTGRRARSPYAY-RGRSISRSPSPDGSPKRIRRGRGFSHRYSYARR 481 NNRRS SRSP RR RSP + RGRS+SRS SPDGSPKRIRRGRGFS RYSYARR Sbjct: 622 NNRRSYSRSPSPVARRVRSPMSPDRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARR 678